Potri.013G083600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
AT5G58400 409 / 3e-144 Peroxidase superfamily protein (.1)
AT5G58390 399 / 3e-140 Peroxidase superfamily protein (.1)
AT1G14550 341 / 2e-117 Peroxidase superfamily protein (.1)
AT1G14540 332 / 5e-114 Peroxidase superfamily protein (.1)
AT5G06720 331 / 3e-113 ATPA2 peroxidase 2 (.1)
AT5G06730 326 / 6e-111 Peroxidase superfamily protein (.1)
AT2G18150 323 / 6e-110 Peroxidase superfamily protein (.1)
AT4G36430 322 / 9e-110 Peroxidase superfamily protein (.1)
AT2G18140 320 / 9e-109 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G156500 466 / 2e-166 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.013G156400 427 / 1e-150 AT5G05340 412 / 1e-144 Peroxidase superfamily protein (.1)
Potri.014G143200 414 / 3e-146 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.013G154400 401 / 5e-141 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.001G458900 386 / 4e-135 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1)
Potri.001G458700 384 / 3e-134 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
Potri.010G236870 380 / 8e-133 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236890 378 / 5e-132 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.010G236900 378 / 7e-132 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034207 501 / 2e-180 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10006534 408 / 1e-143 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10000346 409 / 6e-143 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10030148 398 / 3e-140 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10030149 400 / 5e-140 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1)
Lus10009932 402 / 1e-139 AT5G05340 419 / 6e-146 Peroxidase superfamily protein (.1)
Lus10009934 389 / 1e-136 AT5G05340 372 / 5e-130 Peroxidase superfamily protein (.1)
Lus10032786 386 / 5e-135 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10003573 382 / 1e-133 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Lus10009936 379 / 4e-132 AT5G05340 361 / 5e-125 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.013G083600.1 pacid=42812466 polypeptide=Potri.013G083600.1.p locus=Potri.013G083600 ID=Potri.013G083600.1.v4.1 annot-version=v4.1
ATGGATTCTTCGTCATTTTCCAAAGCCATTGTAACCTTGGCCATCCTAGTTATGCTCTCCATGGGGAGCTCCAATGCTCAGCTTTCAATAGATTTCTACT
CCAAATCTTGCCCACATCTCCTTTCAACAGTTAAACCTGTTGTTCAATCTGCCATAAACAAAGAAGCACGTATGGGTGCATCAATTCTTCGTTTATTCTT
CCACGACTGTTTTGTTAATGGATGTGATGGATCACTTTTACTTGATGACACGTCTTCTTTCACCGGAGAGAAAAATGCAGCTCCAAACAAGAATTCTGCG
AGAGGATTTGAGGTCATTGACAACATAAAGTCCGCAGTTGAGAAAGCATGTCCTGGTGTGGTCTCATGTGCTGATATACTGGCCATTGCTGCTAGAGACT
CCACTGTTATTCTTGGAGGACCCGAATGGGACGTTAAACTTGGAAGGAGAGATGCAAGAACTGCGAGCCAGGCTGCTGCCAACAATAGCATTCCACGTCC
AACTTCTAACTTGAACCAGCTCATTTCTAGATTCAATGCTCTTGGCCTGTCCACCAGAGATATGGTGGCTTTATCTGGTTCCCACACAATTGGACAAGCA
AGATGCACAAACTTTAGGGCACGCATATATAATGAGACCACCATAGACAGTTCCTTGGCTCAGACAAGAAGGTCAAACTGCCCACGTACTTCTGGCTCGG
GGGACAACAACTTGGCACCACTTGATTTGCAAACTCCTACACGTTTTGAGAACAATTATTACAAGAACTTGATTAACAGGAGGGGCTTGCTCCATTCTGA
TCAACAGTTGTTCAATGGAGGATCCACTGATTCAATAGTCAGTACCTATAGCTCCAATGAAAACACCTTCAGATCAGATTTTGTTGCTGGCATGATCAAG
ATGGGAGATATCAGGCCTCTCACTGGATCCAGAGGAGAGATTAGAAATAATTGCAGGAGGATCAACTAA
AA sequence
>Potri.013G083600.1 pacid=42812466 polypeptide=Potri.013G083600.1.p locus=Potri.013G083600 ID=Potri.013G083600.1.v4.1 annot-version=v4.1
MDSSSFSKAIVTLAILVMLSMGSSNAQLSIDFYSKSCPHLLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLLLDDTSSFTGEKNAAPNKNSA
RGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGPEWDVKLGRRDARTASQAAANNSIPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQA
RCTNFRARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLINRRGLLHSDQQLFNGGSTDSIVSTYSSNENTFRSDFVAGMIK
MGDIRPLTGSRGEIRNNCRRIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G05340 Peroxidase superfamily protein... Potri.013G083600 0 1
AT4G21440 MYB ATMYB102, ATM4 A. THALIANA MYB 4, MYB-like 10... Potri.004G033100 1.41 0.9355 MYB.53
Potri.006G240450 2.82 0.8762
AT4G18170 WRKY ATWRKY28, WRKY2... WRKY DNA-binding protein 28 (.... Potri.005G203200 3.16 0.8932
AT5G24080 Protein kinase superfamily pro... Potri.012G034901 7.93 0.8761
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.016G046500 8.12 0.8400
AT2G42560 late embryogenesis abundant do... Potri.013G118600 8.12 0.8893
AT4G03620 myosin heavy chain-related (.1... Potri.011G091700 8.36 0.8589
AT2G28690 Protein of unknown function (D... Potri.001G235200 8.48 0.8650
Potri.010G072200 9.16 0.8839
Potri.010G134450 10.00 0.8802

Potri.013G083600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.