Potri.013G083700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56250 59 / 2e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G055900 158 / 9e-49 AT3G56250 53 / 1e-08 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030552 60 / 1e-10 AT3G56250 57 / 4e-09 unknown protein
PFAM info
Representative CDS sequence
>Potri.013G083700.5 pacid=42811489 polypeptide=Potri.013G083700.5.p locus=Potri.013G083700 ID=Potri.013G083700.5.v4.1 annot-version=v4.1
ATGGAAGCAGAGAATATTAGGATTAATAATAATAATAATAATAAGAAAAGAAGCAGCAGAAAGCCACTGGCAGATTGCACGAACCTTTCACCATCTTCCT
CAACATCATCGACTAACAACATTCCTTCTTCTTCTTCTTTTAAGAAACCATCCATTCTCTCCTTTTCTCTTAATAAATTCCCAAACACCAAAAATAAACC
TGGATCCACCCCTTCCCACAAGACCCCTGCTTCCAAATCCGCCGCCGTTTCGCCCCCGACACCTTCTCACCCACCTGAATCCTCTCCTCTCCCTGGAAGT
TTCGGTGATGAGATTTTTGAGCCGCATTCAGTTTACACTCGGAGACAGTCTACCGAAGGTAAAAGGAAGAGTAAAGGGAGGGCAAGTTTCACTCCTGCAC
CGAAGACCGAATTCGCCTCGTATAAAATGAATGATGTTGGAGTTACTCATCCATCCAAGTCCTTGGCAGTGCATCGCAAAAAGAGACGATGTGGGGCACT
GTCTGATGGAGATGAGAAGAAGCATGCCCTGCCACAGGATTATATTGAGCAGCAGAGAGCTTACTTTGCAGAAATCGATGCATTTGAACTCTCCGAGGAG
GAGGTTGGTTCAAGTAATGAGTTGGACTGA
AA sequence
>Potri.013G083700.5 pacid=42811489 polypeptide=Potri.013G083700.5.p locus=Potri.013G083700 ID=Potri.013G083700.5.v4.1 annot-version=v4.1
MEAENIRINNNNNNKKRSSRKPLADCTNLSPSSSTSSTNNIPSSSSFKKPSILSFSLNKFPNTKNKPGSTPSHKTPASKSAAVSPPTPSHPPESSPLPGS
FGDEIFEPHSVYTRRQSTEGKRKSKGRASFTPAPKTEFASYKMNDVGVTHPSKSLAVHRKKRRCGALSDGDEKKHALPQDYIEQQRAYFAEIDAFELSEE
EVGSSNELD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G56250 unknown protein Potri.013G083700 0 1
AT1G67410 Exostosin family protein (.1) Potri.008G034500 1.41 0.9331
AT5G27000 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABID... Potri.013G011500 2.64 0.9338
AT1G32100 ATPRR1 pinoresinol reductase 1 (.1) Potri.001G133300 2.64 0.9012 PCBERp4
AT1G16290 unknown protein Potri.008G084100 3.16 0.9059
AT4G18060 SH3 domain-containing protein ... Potri.011G077500 3.46 0.9072
AT2G27060 Leucine-rich repeat protein ki... Potri.009G159101 4.89 0.9008
AT5G64390 HEN4 HUA ENHANCER 4, RNA-binding KH... Potri.007G116300 5.19 0.8924
AT2G04340 unknown protein Potri.001G240904 6.48 0.8734
AT4G01710 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa... Potri.014G045200 7.54 0.8704 Pt-CRK.1
AT1G29200 O-fucosyltransferase family pr... Potri.004G058900 8.71 0.8394

Potri.013G083700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.