Potri.013G083800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56230 305 / 2e-104 BTB/POZ domain-containing protein (.1)
AT1G01640 184 / 6e-58 BTB/POZ domain-containing protein (.1.2)
AT4G04090 112 / 2e-30 BTB/POZ domain-containing protein (.1)
AT2G40450 112 / 3e-30 BTB/POZ domain-containing protein (.1)
AT5G48510 103 / 9e-27 BTB/POZ domain-containing protein (.1)
AT2G05330 97 / 3e-24 BTB/POZ domain-containing protein (.1)
AT2G40440 84 / 2e-19 BTB/POZ domain-containing protein (.1)
AT1G21780 75 / 3e-15 BTB/POZ domain-containing protein (.1.2)
AT4G08455 73 / 3e-15 BTB/POZ domain-containing protein (.1)
AT3G29740 62 / 3e-12 BTB/POZ domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G183600 77 / 2e-16 AT4G08455 342 / 2e-119 BTB/POZ domain-containing protein (.1)
Potri.002G077000 76 / 9e-16 AT4G08455 369 / 2e-130 BTB/POZ domain-containing protein (.1)
Potri.001G468700 72 / 2e-14 AT1G55760 522 / 0.0 BTB/POZ domain-containing protein (.1)
Potri.002G082800 63 / 2e-11 AT1G21780 535 / 0.0 BTB/POZ domain-containing protein (.1.2)
Potri.005G178400 62 / 6e-11 AT1G21780 543 / 0.0 BTB/POZ domain-containing protein (.1.2)
Potri.012G091400 57 / 3e-09 AT5G63160 404 / 7e-141 BTB and TAZ domain protein 1 (.1)
Potri.015G087700 56 / 8e-09 AT5G63160 404 / 8e-141 BTB and TAZ domain protein 1 (.1)
Potri.019G039500 54 / 6e-08 AT3G03740 618 / 0.0 BTB-POZ and MATH domain 4 (.1)
Potri.007G140400 51 / 4e-07 AT1G05690 407 / 3e-141 BTB and TAZ domain protein 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010216 150 / 8e-45 AT3G56230 132 / 3e-38 BTB/POZ domain-containing protein (.1)
Lus10017414 124 / 2e-34 AT3G56230 102 / 3e-26 BTB/POZ domain-containing protein (.1)
Lus10042763 74 / 3e-15 AT4G08455 354 / 1e-124 BTB/POZ domain-containing protein (.1)
Lus10008348 74 / 5e-15 AT1G55760 516 / 0.0 BTB/POZ domain-containing protein (.1)
Lus10029732 72 / 1e-14 AT4G08455 354 / 2e-124 BTB/POZ domain-containing protein (.1)
Lus10042717 66 / 5e-12 AT1G21780 557 / 0.0 BTB/POZ domain-containing protein (.1.2)
Lus10042583 66 / 6e-12 AT5G19330 822 / 0.0 ARM repeat protein interacting with ABF2 (.1.2)
Lus10029677 66 / 6e-12 AT1G21780 538 / 0.0 BTB/POZ domain-containing protein (.1.2)
Lus10027101 64 / 2e-11 AT1G55760 389 / 3e-136 BTB/POZ domain-containing protein (.1)
Lus10022039 61 / 3e-10 AT5G13060 821 / 0.0 ARMADILLO BTB protein 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0033 POZ PF00651 BTB BTB/POZ domain
Representative CDS sequence
>Potri.013G083800.2 pacid=42812415 polypeptide=Potri.013G083800.2.p locus=Potri.013G083800 ID=Potri.013G083800.2.v4.1 annot-version=v4.1
ATGGACTGCTCAATTTGTTGCTCTATGCCATTGATCTTAAGGCCTCCAAGGAATACCATTTGCGGAGCATGCTACGAGGGAGCTAAGAGCGTCATCACCT
TGATGAACAAGCTTGAAAGTGATGAAACAGCTGACAAGGCCACCAATTCTCTACCTTCTTCGCCAAATCCGTGTAAGCCTCAGCCACTTGCTAATATTCC
AAGATGGATGATTAGTATGAAGGATAGAGAATCTGAACTGAATGAGAAGATAAGTTTTCTCAGTAGCTTTATTGCCTTATTTAAAGATCAAATTCTCACG
GACATACAACTCAAGCCTGGCAATGATGGGCCTTCCATATCTGCACACAGAGCATTACTGGCAGCAAGATCTGAAATATTTAAGAACATGCTGGACTCAG
ATGCCTACAAAGCTCCTGCAAGCGACACCATAATGCTCCCTGAATTGAACCATCAAGAGCTTGAGTCTCTATTAGAATTTCTTTACAGTGGAAACTTGCC
TAGCGAAAAGCTGGAGAAGCATGTCTACTCATTGACCCTTGCAGCTGACAAATATGATATTCCATACCTGCTCAAATTTTGCGAAAGGCATATGCTCAGA
TTCCTGAACTCATCTAATGCTCTTGACGTGTTAGAAATCTCGGATACATGTTCCAACAAAACACTAAAGGAGACTGCCTTGAATTTCATTGTAAAAAACA
TGGAGGATGTAGTTTTTTCTACTAAATATGAAGCTTTTGTACCGGAGAACCCACATTTAGCTGTGCAGATTACGAGGGCTCTTTTGATGGATGTCAAAAA
TAGAAGAAATAGTGGAGTTTGA
AA sequence
>Potri.013G083800.2 pacid=42812415 polypeptide=Potri.013G083800.2.p locus=Potri.013G083800 ID=Potri.013G083800.2.v4.1 annot-version=v4.1
MDCSICCSMPLILRPPRNTICGACYEGAKSVITLMNKLESDETADKATNSLPSSPNPCKPQPLANIPRWMISMKDRESELNEKISFLSSFIALFKDQILT
DIQLKPGNDGPSISAHRALLAARSEIFKNMLDSDAYKAPASDTIMLPELNHQELESLLEFLYSGNLPSEKLEKHVYSLTLAADKYDIPYLLKFCERHMLR
FLNSSNALDVLEISDTCSNKTLKETALNFIVKNMEDVVFSTKYEAFVPENPHLAVQITRALLMDVKNRRNSGV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G56230 BTB/POZ domain-containing prot... Potri.013G083800 0 1
AT3G24840 Sec14p-like phosphatidylinosit... Potri.002G243000 1.41 0.9612
AT3G55990 TBL29, ESK1 TRICHOME BIREFRINGENCE-LIKE 29... Potri.008G069900 1.41 0.9719
AT2G37090 IRX9 IRREGULAR XYLEM 9, Nucleotide-... Potri.006G131000 3.87 0.9602
AT4G38660 Pathogenesis-related thaumatin... Potri.002G020400 4.47 0.9331
AT2G28315 Nucleotide/sugar transporter f... Potri.004G211900 5.29 0.9563
AT5G43100 Eukaryotic aspartyl protease f... Potri.005G144600 6.00 0.9543
AT1G48850 EMB1144 embryo defective 1144, chorism... Potri.010G221600 8.24 0.8992
AT2G34410 RWA3 REDUCED WALL ACETYLATION 3, O-... Potri.011G079400 8.36 0.9562
AT3G46440 UXS5 UDP-XYL synthase 5 (.1.2) Potri.001G237200 8.48 0.9398
AT1G67510 Leucine-rich repeat protein ki... Potri.010G058200 8.48 0.9267

Potri.013G083800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.