Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65290 188 / 5e-63 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT2G44620 128 / 2e-39 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT5G47630 83 / 2e-21 MTACP3 mitochondrial acyl carrier protein 3 (.1.2) AT3G05020 63 / 2e-13 ACP1 acyl carrier protein 1 (.1) AT5G36280 60 / 7e-13 unknown protein AT5G27200 58 / 2e-11 ACP5 acyl carrier protein 5 (.1) AT1G54580 56 / 1e-10 ACP2 acyl carrier protein 2 (.1) AT1G54630 54 / 4e-10 ACP3 acyl carrier protein 3 (.1.2) AT4G25050 51 / 5e-09 ACP4 acyl carrier protein 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G055300 [exp] 242 / 3e-84 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.014G044000 [exp] 123 / 3e-37 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.002G135600 [exp] 107 / 4e-31 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1) Potri.016G006300 [exp] 84 / 9e-22 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G005700 [exp] 84 / 1e-21 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G217800 [exp] 57 / 3e-11 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.005G044800 [exp] 55 / 3e-10 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.012G105300 [exp] 53 / 1e-09 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.015G104500 [exp] 53 / 2e-09 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020221 [exp] 205 / 1e-69 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 203 / 4e-63 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10019500 [exp] 127 / 7e-39 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10043348 [exp] 127 / 7e-39 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10038782 [exp] 79 / 1e-19 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2) Lus10000050 [exp] 79 / 1e-19 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10039077 [exp] 79 / 1e-19 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10037910 [exp] 58 / 2e-11 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 58 / 2e-11 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10038636 [exp] 58 / 2e-11 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [poplar] [flax] PP-binding PF00550 [poplar] [flax] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Potri.013G084500.1 pacid=42811661 polypeptide=Potri.013G084500.1.p locus=Potri.013G084500 ID=Potri.013G084500.1.v4.1 annot-version=v4.1 ATGGCGGCGAGAGGAGGAGCTTTGCTGAAGTACCTGAGAGTGAGTGTAAAGGCCTCACCTACTACTAGAAACCCTAACAACAACGGCCTCTTCGGTCTCT CCTTCAATACCATCTGCCGCCGTTTCTCCGAGGAAGTTAGAGGCACCTTTCTTGACAAATCCGAGGTCTCCGATCGAGTTGTCAATGTTGTCAAGAACTT CCAGAAAGTCGATCCTTCCAAGGTTACACCTGATGCCCATTTCCAGAATGATCTTGGGTTAGATAGTTTAGACACTGTTGAGATTGTGATGGCCCTTGAA GAAGAGTTTAAGTTTGAGATCCCAGATAATGAAGCAGACAAGATCAGTACCGTCAGTCTTGCCATTGACTTCATATCTTCTCACCCTCAAGCAAAGTAG
AA sequence Show only first row Show all	>Potri.013G084500.1 pacid=42811661 polypeptide=Potri.013G084500.1.p locus=Potri.013G084500 ID=Potri.013G084500.1.v4.1 annot-version=v4.1 MAARGGALLKYLRVSVKASPTTRNPNNNGLFGLSFNTICRRFSEEVRGTFLDKSEVSDRVVNVVKNFQKVDPSKVTPDAHFQNDLGLDSLDTVEIVMALE EEFKFEIPDNEADKISTVSLAIDFISSHPQAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65290		MTACP2	mitochondrial acyl carrier pro...		Potri.013G084500 [exp]	0	1
AT1G57720			Translation elongation factor ...		Potri.004G226300 [exp]	4.47	0.8770
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Potri.016G079800 [exp]	5.65	0.9061
AT5G35530			Ribosomal protein S3 family pr...		Potri.018G049100 [exp]	6.63	0.8947
AT5G42790		ARS5, ATPSM30, ...	ARSENIC TOLERANCE 5, proteasom...		Potri.002G033900 [exp]	6.85	0.8497
AT4G37450		ATAGP18, AGP18	arabinogalactan protein 18 (....		Potri.007G051600 [exp]	7.48	0.8709
AT3G57490			Ribosomal protein S5 family pr...		Potri.006G052400 [exp]	10.29	0.8977	Pt-RPS2.2
AT5G24510			60S acidic ribosomal protein f...		Potri.002G179400 [exp]	12.00	0.8925
AT5G15610			Proteasome component (PCI) dom...		Potri.017G095300 [exp]	14.56	0.8400
AT3G56340			Ribosomal protein S26e family ...		Potri.013G093700 [exp]	17.34	0.8850	RPS26.1
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.016G069000 [exp]	19.28	0.8976

Compare expression of checked genes

Potri.013G084500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.