Potri.013G084900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47840 196 / 1e-63 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
AT5G55710 112 / 8e-31 AtTic20-V translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G191700 110 / 3e-30 AT5G55710 228 / 2e-76 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020219 195 / 6e-63 AT2G47840 222 / 1e-73 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Lus10026842 194 / 2e-62 AT2G47840 219 / 1e-72 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Lus10031203 110 / 4e-30 AT5G55710 263 / 3e-90 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Lus10031781 108 / 2e-29 AT5G55710 267 / 1e-91 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF16166 TIC20 Chloroplast import apparatus Tic20-like
Representative CDS sequence
>Potri.013G084900.1 pacid=42811548 polypeptide=Potri.013G084900.1.p locus=Potri.013G084900 ID=Potri.013G084900.1.v4.1 annot-version=v4.1
ATGGCTTCCATCTCTCTCCTGCGCCTATCTCTCATTCCCACACCAAAAACCCTATCAAAATCCCACCCCTTTTCTTCCTTCAACCCTCCCTTAACTCCCT
TTCTCAAATTCCCCCCTAAAACCCGTCTGTCACAAAAATCCACCGTCACCCGCATGTCATACAATCCCACGCCCGCCACAGATCGGTTAGTCTCGGCCGT
TTCTTACACCCTCCCTTTCTTTAACTCTCTCCAGTACGGACGGTTTCTTTTCACTACATACCCATCTCTTGCTCTCCTAGTTGACCCTCTAATCCCTCTC
TTAAGCCTCTACAGATCAATCCCATATGCAAGTTTTGTGGCTTTTTTTGCTCTCTACTTGGGTGTGGTGAGAAACCCAAGTTTTAGCCAGTACGTGAGGT
TCAATGCTATGCAAGCTGTGACGTTAGATGTTCTATTGGTGGTGCCTTTGCTTTTGACCCGGATCCTCAGTCCGGGCCGGGCCGGGTTAGGGTTTAAGTT
GATGGTTTGGGGTCATAATGCTCTGTTTCTGTTTAGTTGCTTCTGTTTTGTTTATGGGTTGGCAAGTTCTGTTTTGGGTAAGACTCCTTATTTGCCCTTT
ATTGCTGAGGCTGCTGGTAGACAAGTATGA
AA sequence
>Potri.013G084900.1 pacid=42811548 polypeptide=Potri.013G084900.1.p locus=Potri.013G084900 ID=Potri.013G084900.1.v4.1 annot-version=v4.1
MASISLLRLSLIPTPKTLSKSHPFSSFNPPLTPFLKFPPKTRLSQKSTVTRMSYNPTPATDRLVSAVSYTLPFFNSLQYGRFLFTTYPSLALLVDPLIPL
LSLYRSIPYASFVAFFALYLGVVRNPSFSQYVRFNAMQAVTLDVLLVVPLLLTRILSPGRAGLGFKLMVWGHNALFLFSCFCFVYGLASSVLGKTPYLPF
IAEAAGRQV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G47840 AtTic20-II translocon at the inner envelo... Potri.013G084900 0 1
AT1G64500 Glutaredoxin family protein (.... Potri.003G141800 10.34 0.9002
AT1G75100 JAC1 J-domain protein required for ... Potri.002G134300 11.22 0.8972
AT5G50740 Heavy metal transport/detoxifi... Potri.006G006100 12.12 0.8732
AT5G19590 Protein of unknown function, D... Potri.006G158952 15.65 0.8813
AT1G45616 AtRLP6 receptor like protein 6 (.1) Potri.011G021332 19.49 0.8885
AT1G07010 AtSLP1 Shewenella-like protein phosph... Potri.009G077900 21.63 0.8965
AT2G41310 ARR8, ATRR3 RESPONSE REGULATOR 8, response... Potri.016G038000 22.18 0.8610
AT2G01670 ATNUDT17 nudix hydrolase homolog 17 (.1... Potri.017G131000 30.00 0.8523
AT4G36920 AP2_ERF FL1, FLO2, AP2 FLORAL MUTANT 2, FLOWER 1, APE... Potri.005G140700 33.22 0.8591 Pt-AP2.14
AT3G18950 Transducin/WD40 repeat-like su... Potri.004G148400 33.46 0.8795

Potri.013G084900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.