Potri.013G086500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02800 296 / 3e-103 AtPFA-DSP3 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
AT5G16480 284 / 1e-98 AtPFA-DSP5 plant and fungi atypical dual-specificity phosphatase 5, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT1G05000 219 / 1e-72 AtPFA-DSP1 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
AT4G03960 204 / 3e-67 AtPFA-DSP4 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT2G32960 196 / 5e-63 AtPFA-DSP2 plant and fungi atypical dual-specificity phosphatase 2, Phosphotyrosine protein phosphatases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G021100 212 / 6e-70 AT4G03960 288 / 4e-100 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
Potri.004G002800 210 / 3e-69 AT1G05000 286 / 4e-99 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.014G159100 209 / 1e-68 AT1G05000 310 / 3e-108 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.002G224000 201 / 6e-66 AT1G05000 300 / 9e-105 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031529 215 / 2e-71 AT1G05000 304 / 2e-106 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10029991 206 / 5e-67 AT1G05000 296 / 1e-102 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10015154 205 / 5e-67 AT1G05000 298 / 3e-103 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10035333 204 / 2e-66 AT1G05000 291 / 2e-100 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF13350 Y_phosphatase3 Tyrosine phosphatase family
Representative CDS sequence
>Potri.013G086500.2 pacid=42812720 polypeptide=Potri.013G086500.2.p locus=Potri.013G086500 ID=Potri.013G086500.2.v4.1 annot-version=v4.1
ATGTGCATGATGATAGTGGATGTTGAGGAGAACGACGACGTTTTGGTACCGCCAACCAATTTCTCCATGGTAGAAGACGGCATTTTCAGATCTGGCCTCC
CTCAACCCTCCAATTTCGGTTTCCTTGAAACCCTAAATCTTCGATCAATCATATACTTGTGTCCAGAGGCTTATCCACAAGAGAATATGGACTTTGTTGA
TGCTCATGATATTAAGCTCTTCCAGTTTGGAATAGAAGGCAAAACGGAGTCGTCTTCTACGTCGATTCCCAACCATACTATAACGGGGGCTCTTAAAGTG
TTAATTGACGTGAGGAATCATCCAGTTCTGATTCATTGCAAACGTGGAAAGCATCGGACAGGTTGTCTTGTGGGTTGCTTTAGAAAACTGCAAACTTGGT
GCCTGTCTTCAGTTTTCGAGGAATACCAGCGTTTTGCTGGGGTGAAATGGAGGGCCACTGACTTGAGGTTTATTGAGACCTTCGAAGTAATGTGCCTGAG
GCAGTGTCTATACAGCATCATATACCAGTATCAAGGATATGGCTCAAACAAGAGGAGGTTACTTTACCAGGAAGAGAGTATACAGAAGCCAAAAATTAAG
TCCATTTAA
AA sequence
>Potri.013G086500.2 pacid=42812720 polypeptide=Potri.013G086500.2.p locus=Potri.013G086500 ID=Potri.013G086500.2.v4.1 annot-version=v4.1
MCMMIVDVEENDDVLVPPTNFSMVEDGIFRSGLPQPSNFGFLETLNLRSIIYLCPEAYPQENMDFVDAHDIKLFQFGIEGKTESSSTSIPNHTITGALKV
LIDVRNHPVLIHCKRGKHRTGCLVGCFRKLQTWCLSSVFEEYQRFAGVKWRATDLRFIETFEVMCLRQCLYSIIYQYQGYGSNKRRLLYQEESIQKPKIK
SI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G02800 AtPFA-DSP3 plant and fungi atypical dual-... Potri.013G086500 0 1
AT1G53720 ATCYP59, CYP59 cyclophilin 59 (.1) Potri.007G067000 14.66 0.7247
Potri.013G066750 20.83 0.7224
AT5G51890 Peroxidase superfamily protein... Potri.015G138300 26.38 0.7104
AT3G58750 CSY2 citrate synthase 2 (.1) Potri.016G089300 30.44 0.6066
AT4G28540 CKL6, PAPK1 casein kinase I-like 6 (.1) Potri.002G036000 30.98 0.5717
Potri.009G071750 33.88 0.7092
Potri.006G216950 40.76 0.6951
Potri.008G214723 43.23 0.6909
AT1G15780 unknown protein Potri.003G013900 43.90 0.6900
Potri.001G210150 51.78 0.6774

Potri.013G086500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.