Potri.013G091600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G54190 337 / 3e-115 Transducin/WD40 repeat-like superfamily protein (.1)
AT2G38630 317 / 2e-107 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G091700 379 / 1e-131 AT3G54190 764 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.013G091800 371 / 1e-129 AT3G54190 722 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.019G064100 369 / 7e-128 AT3G54190 812 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.016G142600 340 / 2e-116 AT3G54190 837 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.006G113000 326 / 5e-111 AT3G54190 814 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035613 281 / 2e-93 AT3G54190 754 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003237 265 / 7e-87 AT3G54190 751 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.013G091600.2 pacid=42811321 polypeptide=Potri.013G091600.2.p locus=Potri.013G091600 ID=Potri.013G091600.2.v4.1 annot-version=v4.1
ATGGTACTGCCATTTTTAAGAAAGAGATCAAAGATTATTGAGATCGCAGCAGCTCGTGACATGGTGTTTGCTCTTGCACAGTCTGGTGTCTGTGCAGCAT
TTAGCCGAGAGACCAACCAAAGGATATGCTTTTTGAATGTCACTCCTGATGAAGTTATACGAAGCTTAAGCACAAGGATTGAATACATACAAAGGGGTCA
GCCAGATGCTGGCTTTGCTCTTTTTGAGTCCGAGTCACTGAAATGGCCTGGTTTTGTAGAGTTTGATGATGTAAACAGTAAAGTACTTACATATTCTGCA
CAGGATAGTATATACAAGGTGTTTGACCTAAAAAATTACACAATGTTATACTCGATAGCAAACAAAAATGTTCAAGAGATTAAGATCAGTCCAGGGATCA
TGTTGTTGATTTTAACTAAAAGTGGTGGCTGTGTTCCTCTTGAGATTCTTTCGATAGAGGATGTCACTGTTCTCAAATCTTTCAATCATCTCCTTCATCG
GAATAAGAAGGTGGATTTCATTGAAAAGTTCAATGAGAAGCTTCTTGTCAAGCAAGAAAATGAAAATCTCCAGATTCTTGATGCAAGGATCACTGTTGTT
ATCTTCAAATATTTCTTCATCCATACACAAAAATGCACAAAAATCATTAGGATGGACCATAACTGA
AA sequence
>Potri.013G091600.2 pacid=42811321 polypeptide=Potri.013G091600.2.p locus=Potri.013G091600 ID=Potri.013G091600.2.v4.1 annot-version=v4.1
MVLPFLRKRSKIIEIAAARDMVFALAQSGVCAAFSRETNQRICFLNVTPDEVIRSLSTRIEYIQRGQPDAGFALFESESLKWPGFVEFDDVNSKVLTYSA
QDSIYKVFDLKNYTMLYSIANKNVQEIKISPGIMLLILTKSGGCVPLEILSIEDVTVLKSFNHLLHRNKKVDFIEKFNEKLLVKQENENLQILDARITVV
IFKYFFIHTQKCTKIIRMDHN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G54190 Transducin/WD40 repeat-like su... Potri.013G091600 0 1
AT2G01690 ARM repeat superfamily protein... Potri.008G134600 5.00 0.7662
AT5G15070 Phosphoglycerate mutase-like f... Potri.004G129900 15.74 0.7255
AT5G27540 MIRO1, EMB2473 embryo defective 2473, MIRO-re... Potri.005G033700 25.92 0.6201
AT3G52570 alpha/beta-Hydrolases superfam... Potri.016G076601 27.11 0.6373
AT5G08110 nucleic acid binding;ATP-depen... Potri.012G063201 29.41 0.6890
AT5G58290 RPT3 regulatory particle triple-A A... Potri.006G029100 34.75 0.6804
AT2G44680 CKB4 casein kinase II beta subunit... Potri.002G139900 39.68 0.5978 CKB3.2
AT2G26890 KAM2, GRV2 KATAMARI2, GRAVITROPISM DEFECT... Potri.018G072600 49.13 0.6593
AT1G73930 unknown protein Potri.012G060200 49.83 0.6711
AT5G45160 Root hair defective 3 GTP-bind... Potri.015G112700 50.91 0.6134

Potri.013G091600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.