Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPS26.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56340 130 / 4e-40 Ribosomal protein S26e family protein (.1) AT2G40590 129 / 2e-39 Ribosomal protein S26e family protein (.1) AT2G40510 129 / 2e-39 Ribosomal protein S26e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G057000 [exp] 149 / 2e-47 AT3G56340 132 / 6e-41 Ribosomal protein S26e family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030533 [exp] 143 / 4e-45 AT2G40510 185 / 1e-61 Ribosomal protein S26e family protein (.1) Lus10034223 [exp] 140 / 4e-44 AT2G40510 182 / 2e-60 Ribosomal protein S26e family protein (.1) Lus10029042 [exp] 140 / 4e-44 AT2G40510 182 / 2e-60 Ribosomal protein S26e family protein (.1) Lus10012883 [exp] 147 / 1e-43 AT3G10920 356 / 1e-123 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01283 [poplar] [flax] Ribosomal_S26e Ribosomal protein S26e
Representative CDS sequence Show only first row Show all	>Potri.013G093700.1 pacid=42810802 polypeptide=Potri.013G093700.1.p locus=Potri.013G093700 ID=Potri.013G093700.1.v4.1 annot-version=v4.1 ATGACATTCAAGCGTAGGAATGGAGGACGCAACAAGCACGGCCGTGGACATGTTAAGTTCATACGCTGCTCCAACTGCGGAAAATGCTGTCCCAAGGACA AGGCAATTAAGAGGTTTCTAGTGAGGAACATAGTGGAGCAAGCTGCTGTTAGGGATGTTCAAGAGTCCTGTGTTTATGATGGATATGTCTTGCCTAAACT TTATGTCAAGATGCAGTACTGTGTCTCTTGTGCTATTCACTCCCGTGTTGTGAGGGTTCGCTCTAGCTCTGAGCGCAGGAAGAGGGAGCCTCCACAGCGT TTCATTAGACGCAGGGATGACATGCCGAAGCCTGGTCAGCCTGGTCAACCTGGCCAAGCACCTCGGCCTACTGGGGCAGCTCCTGCTCGTGTCTAG
AA sequence Show only first row Show all	>Potri.013G093700.1 pacid=42810802 polypeptide=Potri.013G093700.1.p locus=Potri.013G093700 ID=Potri.013G093700.1.v4.1 annot-version=v4.1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQESCVYDGYVLPKLYVKMQYCVSCAIHSRVVRVRSSSERRKREPPQR FIRRRDDMPKPGQPGQPGQAPRPTGAAPARV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56340			Ribosomal protein S26e family ...		Potri.013G093700 [exp]	0	1	RPS26.1
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Potri.002G056200 [exp]	1.73	0.9531	Pt-RPS12.2
AT1G13950		EIF5A, ATELF5A-...	eukaryotic elongation factor 5...		Potri.010G162800 [exp]	3.46	0.9248
AT1G57720			Translation elongation factor ...		Potri.019G077000 [exp]	4.89	0.9277
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Potri.016G063200 [exp]	5.65	0.9476	Pt-RPS5.1
AT3G59540			Ribosomal L38e protein family ...		Potri.017G026000 [exp]	6.00	0.9169
AT1G51980			Insulinase (Peptidase family M...		Potri.001G191100 [exp]	6.70	0.8844
AT2G46290			Transducin/WD40 repeat-like su...		Potri.008G141400 [exp]	7.54	0.9423	Pt-TRIP.2
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Potri.019G131900 [exp]	12.40	0.9241	Pt-RPL10.4
AT1G57860			Translation protein SH3-like f...		Potri.016G061100 [exp]	15.96	0.9266
AT1G65290		MTACP2	mitochondrial acyl carrier pro...		Potri.013G084500 [exp]	17.34	0.8850

Compare expression of checked genes

Potri.013G093700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.