Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10290 51 / 1e-08 DRP2A, ADL6 DYNAMIN-RELATED PROTEIN 2A, dynamin-like protein 6 (.1) AT1G59610 48 / 2e-07 DRP2B, CF1, ADL3 Dynamin related protein 2B, dynamin-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G068700 [exp] 56 / 2e-10 AT1G59610 1262 / 0.0 Dynamin related protein 2B, dynamin-like 3 (.1) Potri.003G001400 [exp] 51 / 1e-08 AT1G10290 1253 / 0.0 DYNAMIN-RELATED PROTEIN 2A, dynamin-like protein 6 (.1) Potri.004G228400 [exp] 47 / 3e-07 AT1G59610 1301 / 0.0 Dynamin related protein 2B, dynamin-like 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030357 [exp] 52 / 7e-09 AT1G59610 1337 / 0.0 Dynamin related protein 2B, dynamin-like 3 (.1) Lus10007434 [exp] 47 / 2e-07 AT1G59610 1298 / 0.0 Dynamin related protein 2B, dynamin-like 3 (.1) Lus10007887 [exp] 47 / 2e-07 AT1G59610 1337 / 0.0 Dynamin related protein 2B, dynamin-like 3 (.1) Lus10024462 [exp] 46 / 3e-07 AT1G59610 217 / 1e-66 Dynamin related protein 2B, dynamin-like 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G096775.1 pacid=42812514 polypeptide=Potri.013G096775.1.p locus=Potri.013G096775 ID=Potri.013G096775.1.v4.1 annot-version=v4.1 ATGGAAGCGATCGAGGAGTTGTCACAGTTATCGGAGTCGATAATGCAAGCAGCGGCGTTGCTTGCCGATGAGGATGTTGACGAAAATTCGAGTTCAAGTT CAAGACGGAACTCAACTTTTCTTAATGTTGTTGCACTTGGCAATGTAGTAAGTGACTTAATTTACTTGTATTTACAGAATGGATTTGAATTTTTTTTAAG TGAAGAAAAGGAGCTTTTGTTTTTATTTAGTTTTAGATTTTTCTTGATCAGTGACTACAAGGAAGGAAGGGTTATGTACTTGTTTTTTAGGTGA
AA sequence Show only first row Show all	>Potri.013G096775.1 pacid=42812514 polypeptide=Potri.013G096775.1.p locus=Potri.013G096775 ID=Potri.013G096775.1.v4.1 annot-version=v4.1 MEAIEELSQLSESIMQAAALLADEDVDENSSSSSRRNSTFLNVVALGNVVSDLIYLYLQNGFEFFLSEEKELLFLFSFRFFLISDYKEGRVMYLFFR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G10290		DRP2A, ADL6	DYNAMIN-RELATED PROTEIN 2A, dy...		Potri.013G096775 [exp]	0	1
AT5G04930		ALA1	aminophospholipid ATPase 1 (.1...		Potri.016G138000 [exp]	18.05	0.7046
AT5G19660		ATSBT6.1 ,ATS1P	SITE-1 protease (.1)		Potri.018G081400 [exp]	22.27	0.6898
					Potri.007G081750 [exp]	24.18	0.6153
AT5G56340		ATCRT1	RING/U-box superfamily protein...		Potri.001G001500 [exp]	43.72	0.6654
AT3G26935			DHHC-type zinc finger family p...		Potri.017G063800 [exp]	54.47	0.6372
AT3G13530		MAPKKK7, MAP3KE...	MAP3K EPSILON PROTEIN KINASE, ...		Potri.005G094200 [exp]	84.01	0.6266
AT1G10240	FAR1_related	FRS11	FAR1-related sequence 11 (.1)		Potri.002G199300 [exp]	147.41	0.5695
AT3G06340			DNAJ heat shock N-terminal dom...		Potri.008G196201 [exp]	152.20	0.5672
AT4G18010		AT5PTASE2, IP5P...	INOSITOL\(1,4,5\)P3 5-PHOSPHAT...		Potri.001G145900 [exp]	175.27	0.5914
AT4G16110	GARP	ARR2	response regulator 2 (.1)		Potri.002G152900 [exp]	207.58	0.5752

Compare expression of checked genes

Potri.013G096775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.