Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 55 / 6e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 54 / 2e-09 transmembrane receptors;ATP binding (.1.2) AT1G27180 49 / 6e-08 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G69550 49 / 6e-08 disease resistance protein (TIR-NBS-LRR class) (.1) AT5G45230 44 / 6e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G66890 43 / 7e-06 Leucine-rich repeat (LRR) family protein (.1) AT3G51560 42 / 1e-05 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G19500 42 / 2e-05 nucleoside-triphosphatases;transmembrane receptors;nucleotide binding;ATP binding (.1.2) AT4G19050 42 / 3e-05 NB-ARC domain-containing disease resistance protein (.1) AT2G17050 41 / 5e-05 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G097000 [exp] 150 / 1e-43 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G098550 [exp] 150 / 2e-43 AT5G17680 593 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G098000 [exp] 146 / 4e-42 AT5G17680 575 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G103701 [exp] 131 / 1e-36 AT5G17680 544 / 5e-170 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G097300 [exp] 123 / 5e-34 AT5G17680 598 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G104301 [exp] 115 / 5e-31 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G103101 [exp] 113 / 2e-30 AT4G12010 236 / 1e-64 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.017G105201 [exp] 111 / 8e-30 AT4G12010 549 / 4e-174 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.013G097832 [exp] 108 / 8e-29 AT4G12010 148 / 8e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003749 [exp] 78 / 4e-18 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011104 [exp] 68 / 1e-14 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10028042 [exp] 67 / 2e-14 AT5G17680 145 / 2e-38 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10018616 [exp] 54 / 1e-09 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 52 / 7e-09 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 51 / 1e-08 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10041559 [exp] 44 / 2e-06 AT1G69550 88 / 9e-20 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10030839 [exp] 44 / 4e-06 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10029628 [exp] 43 / 8e-06 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029722 [exp] 43 / 1e-05 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G096923.1 pacid=42812619 polypeptide=Potri.013G096923.1.p locus=Potri.013G096923 ID=Potri.013G096923.1.v4.1 annot-version=v4.1 ATGAACAGTTGTAAGAACCTTGAAAGAATTCCCTGTAGCGTAAGTGGTTTGAAATCCCTCAAAAGACTTGATGTGTCTGACTGGTCAGAACTTAAAAACA TAACAGAGAATTTGGGGGAAGTAGAAAGTTTGGAGGAGTTTGATGCAAGTGGAGCTTCAATTAGACAGCATCCGTTGTCTATTTTTCTTTTGAAGAATCT TAGAGTATTGTCTTTTAATGGATGCAAGAGAATAGTTGTGAATCTCACGGATCAAGTATTGCCTTCTTTTGCTGAAAATACCAACTTTAGAAGAACTGGA TTTACGCGCTTGTAA
AA sequence Show only first row Show all	>Potri.013G096923.1 pacid=42812619 polypeptide=Potri.013G096923.1.p locus=Potri.013G096923 ID=Potri.013G096923.1.v4.1 annot-version=v4.1 MNSCKNLERIPCSVSGLKSLKRLDVSDWSELKNITENLGEVESLEEFDASGASIRQHPLSIFLLKNLRVLSFNGCKRIVVNLTDQVLPSFAENTNFRRTG FTRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.013G096923 [exp]	0	1
AT4G27220			NB-ARC domain-containing disea...		Potri.019G020102 [exp]	6.00	0.9600
AT5G17680			disease resistance protein (TI...		Potri.013G097000 [exp]	7.07	0.9438
AT5G36930			Disease resistance protein (TI...		Potri.007G142600 [exp]	8.30	0.9560
AT5G17680			disease resistance protein (TI...		Potri.013G098000 [exp]	8.71	0.9331
AT3G04480			endoribonucleases (.1)		Potri.013G047400 [exp]	10.48	0.9100
AT5G36930			Disease resistance protein (TI...		Potri.007G143200 [exp]	11.22	0.9526
AT1G60500		DRP4C	Dynamin related protein 4C (.1...		Potri.013G124600 [exp]	13.63	0.8821
					Potri.014G177901 [exp]	16.70	0.8978
AT1G25350		OVA9	ovule abortion 9, glutamine-tR...		Potri.010G122866 [exp]	19.59	0.8912
AT5G36930			Disease resistance protein (TI...		Potri.007G143100 [exp]	21.16	0.9370

Compare expression of checked genes

Potri.013G096923 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.