Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PED1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04710 95 / 7e-25 KAT1, PKT4 3-KETO-ACYL-COA THIOLASE 1, peroxisomal 3-ketoacyl-CoA thiolase 4 (.1) AT2G33150 94 / 1e-24 PED1, KAT2, PKT3 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1) AT5G48880 93 / 2e-24 PKT2, PKT1, KAT5 PEROXISOMAL-3-KETO-ACYL-COA THIOLASE 1, 3-KETO-ACYL-COENZYME A THIOLASE 5, peroxisomal 3-keto-acyl-CoA thiolase 2 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G051900 [exp] 95 / 1e-24 AT2G33150 780 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1) Potri.001G051800 [exp] 93 / 3e-24 AT2G33150 673 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1) Potri.002G216400 [exp] 84 / 6e-21 AT2G33150 660 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011879 [exp] 92 / 1e-23 AT2G33150 725 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1) Lus10022812 [exp] 91 / 2e-23 AT2G33150 702 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1) Lus10023672 [exp] 91 / 3e-23 AT2G33150 818 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1) Lus10011748 [exp] 90 / 9e-23 AT2G33150 767 / 0.0 PEROXISOME DEFECTIVE 1, 3-KETOACYL-COA THIOLASE 2, peroxisomal 3-ketoacyl-CoA thiolase 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0046 [poplar] [flax] Thiolase PF02803 [poplar] [flax] Thiolase_C Thiolase, C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.013G097500.1 pacid=42810766 polypeptide=Potri.013G097500.1.p locus=Potri.013G097500 ID=Potri.013G097500.1.v4.1 annot-version=v4.1 ATGTGGTGCAGCAGTTATTTGTTTAATCATTTTCTGAGACTAATTCATGCCTCATCAACTGTTACAGGTGCTAGATGTGTGGCTACTTTACTGCATGAGA TGAAGCGTCGTGGCAGGGACTGTCGCTTCGGGGTGGTGTCAATGTGCATAGGCACAGGAATGGGAGCTGCTGCTGTTTTTGAAAGGGGGGGATGGCTGTG A
AA sequence Show only first row Show all	>Potri.013G097500.1 pacid=42810766 polypeptide=Potri.013G097500.1.p locus=Potri.013G097500 ID=Potri.013G097500.1.v4.1 annot-version=v4.1 MWCSSYLFNHFLRLIHASSTVTGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGGWL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04710		KAT1, PKT4	3-KETO-ACYL-COA THIOLASE 1, pe...		Potri.013G097500 [exp]	0	1	PED1.2
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.016G142700 [exp]	8.48	0.8772
AT4G16380			Heavy metal transport/detoxifi...		Potri.006G018766 [exp]	11.04	0.8227
AT4G39660		AGT2	alanine:glyoxylate aminotransf...		Potri.007G080000 [exp]	11.83	0.8177
					Potri.013G064900 [exp]	13.74	0.8744
					Potri.010G031375 [exp]	15.55	0.8569
AT5G38760			Late embryogenesis abundant pr...		Potri.017G108300 [exp]	15.96	0.8298
AT1G30800			Fasciclin-like arabinogalactan...		Potri.011G155150 [exp]	16.00	0.8632
					Potri.002G006800 [exp]	16.37	0.8184
AT3G17080			Plant self-incompatibility pro...		Potri.015G130300 [exp]	23.49	0.8329
AT5G05210			Surfeit locus protein 6 (.1.2)		Potri.008G173300 [exp]	26.19	0.8652

Compare expression of checked genes

Potri.013G097500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.