Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38344 64 / 4e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G19500 64 / 9e-13 nucleoside-triphosphatases;transmembrane receptors;nucleotide binding;ATP binding (.1.2) AT5G38850 62 / 7e-12 Disease resistance protein (TIR-NBS-LRR class) (.1) AT1G72920 60 / 2e-11 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G16950 60 / 3e-11 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16890 58 / 1e-10 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1) AT4G16900 58 / 1e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16990 58 / 1e-10 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT1G69550 58 / 2e-10 disease resistance protein (TIR-NBS-LRR class) (.1) AT1G72940 57 / 2e-10 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G104301 [exp] 231 / 3e-71 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G103101 [exp] 227 / 5e-71 AT4G12010 236 / 1e-64 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.017G104901 [exp] 224 / 6e-69 AT5G17680 536 / 2e-167 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G105201 [exp] 207 / 5e-63 AT4G12010 549 / 4e-174 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.017G103701 [exp] 197 / 2e-59 AT5G17680 544 / 5e-170 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G097300 [exp] 187 / 5e-56 AT5G17680 598 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G098550 [exp] 135 / 1e-37 AT5G17680 593 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G098000 [exp] 126 / 2e-34 AT5G17680 575 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G097000 [exp] 99 / 9e-25 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030839 [exp] 67 / 1e-13 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10042752 [exp] 64 / 2e-13 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10011104 [exp] 61 / 1e-11 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10024886 [exp] 61 / 2e-11 AT5G36930 370 / 1e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018972 [exp] 60 / 3e-11 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029722 [exp] 60 / 4e-11 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026845 [exp] 59 / 8e-11 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014207 [exp] 58 / 2e-10 AT5G36930 446 / 5e-135 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018024 [exp] 58 / 2e-10 AT5G18350 108 / 2e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10032101 [exp] 57 / 2e-10 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.013G097600.1 pacid=42810825 polypeptide=Potri.013G097600.1.p locus=Potri.013G097600 ID=Potri.013G097600.1.v4.1 annot-version=v4.1 ATGGCCAATGTCTTCCCTGTCACCAGAGTCGCAGATCTAGTCCCGAGATTCATTATGCCAGTCGAGAAAGAACCAGAGAAAGTAATGGCAATTAGATCAA GACTCTTTGAGGCCATTGAAGAATCAGTGCTGTCAATTATTATATTTTCAAGAGATTGTGTTTCTTTACCTTGGTGCTTTGAAGAGCTTGTCAAGATTGT CGGATTCATGGATGAGATGAGATCGGACACTGTGTTTCCAGTTTCTTATGATGTCGAAGAATCAAAGATAGATGATCAAACAGAGAGTTACACAATTGTC TTTGATAAGAATGAAGAACATTTTAGGGAAAACAAGGAGAAGGTACAAAGATGGATGAATATTCTTAGTGCAGTTGAGATATCATCTGGAACGAGATCAT TAAAAAGGTAA
AA sequence Show only first row Show all	>Potri.013G097600.1 pacid=42810825 polypeptide=Potri.013G097600.1.p locus=Potri.013G097600 ID=Potri.013G097600.1.v4.1 annot-version=v4.1 MANVFPVTRVADLVPRFIMPVEKEPEKVMAIRSRLFEAIEESVLSIIIFSRDCVSLPWCFEELVKIVGFMDEMRSDTVFPVSYDVEESKIDDQTESYTIV FDKNEEHFRENKEKVQRWMNILSAVEISSGTRSLKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G38344			Toll-Interleukin-Resistance (T...		Potri.013G097600 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Potri.017G104301 [exp]	10.95	0.7412
AT1G20650		ASG5	ALTERED SEED GERMINATION 5, Pr...		Potri.005G252000 [exp]	13.00	0.7253
AT5G18470			Curculin-like (mannose-binding...		Potri.005G015300 [exp]	18.13	0.7413
AT4G12010			Disease resistance protein (TI...		Potri.013G097832 [exp]	18.33	0.7053
AT3G11760			unknown protein		Potri.018G027200 [exp]	20.49	0.7297
AT1G28760			Uncharacterized conserved prot...		Potri.013G064800 [exp]	24.49	0.7054
AT5G55850		NOI	RPM1-interacting protein 4 (RI...		Potri.001G368900 [exp]	32.78	0.6502
AT5G45290			RING/U-box superfamily protein...		Potri.014G053500 [exp]	33.19	0.6764
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Potri.003G121200 [exp]	34.77	0.6588	DREB64
AT5G41590			Protein of unknown function (D...		Potri.003G133200 [exp]	37.33	0.7192

Compare expression of checked genes

Potri.013G097600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.