Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 160 / 6e-46 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 142 / 1e-39 transmembrane receptors;ATP binding (.1.2) AT1G72920 135 / 1e-39 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G17680 140 / 4e-39 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT4G16950 139 / 2e-38 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72940 134 / 4e-38 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G44510 137 / 6e-38 TAO1 target of AVRB operation1 (.1) AT1G72930 127 / 9e-38 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72900 132 / 1e-37 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72890 133 / 2e-37 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G097050 [exp] 350 / 7e-126 AT5G36930 158 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G096849 [exp] 327 / 3e-116 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G098000 [exp] 341 / 2e-110 AT5G17680 575 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G097000 [exp] 338 / 6e-110 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G098550 [exp] 334 / 1e-107 AT5G17680 593 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G105501 [exp] 282 / 9e-99 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G104301 [exp] 285 / 8e-90 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G105201 [exp] 275 / 2e-86 AT4G12010 549 / 4e-174 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.017G103701 [exp] 272 / 3e-85 AT5G17680 544 / 5e-170 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011104 [exp] 194 / 1e-57 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 173 / 2e-50 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10030839 [exp] 173 / 3e-50 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10042752 [exp] 155 / 7e-49 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10006929 [exp] 157 / 4e-48 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10003749 [exp] 166 / 1e-47 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 163 / 2e-47 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014671 [exp] 152 / 3e-46 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029722 [exp] 155 / 4e-44 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10006928 [exp] 151 / 2e-43 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.013G098100.1 pacid=42811804 polypeptide=Potri.013G098100.1.p locus=Potri.013G098100 ID=Potri.013G098100.1.v4.1 annot-version=v4.1 ATGGCCTCATCCAGCATGCAGAAAGGAACCTCATCTTCTTATTCTGCTCCCCAATGGATGTATGATGTCTACCTTAGTTTTAGAGGCAAAGACACACGGA ATAACTTTACTAGCCATCTATATTCTAATTTGGAACAAAGAGGCATCGATGTATACATGGATGATAGCGGGCTAGAGAGAGGAAAGACCATCGAACCTGC TCTCTGGCAGGCCATCGAAGATTCAAGATTTTCAATCGTTGTGTTTTCAAGAGATTACGCGTCTTCACCATGGTGCTTAGATGAGCTTGTCAAGATTGTT CAGTGCATGAAAGAGATGGGGCACACTGTTCTACCAGTTTTTTATGATGTGGATCCATCAGAGGTAGCCGATCAGAAAAGGAATTATAAGAAGGCGTTCA TTGAGCATAAGGAAAAGTTCTCGGAAAATTTGGACAAGGTAAAATGCTGGAGTGATTGTCTCTCCACAGTGGCCAATTTATCTGGTTGGGATGTACGGAA TAGGTAA
AA sequence Show only first row Show all	>Potri.013G098100.1 pacid=42811804 polypeptide=Potri.013G098100.1.p locus=Potri.013G098100 ID=Potri.013G098100.1.v4.1 annot-version=v4.1 MASSSMQKGTSSSYSAPQWMYDVYLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIV QCMKEMGHTVLPVFYDVDPSEVADQKRNYKKAFIEHKEKFSENLDKVKCWSDCLSTVANLSGWDVRNR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.013G098100 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.013G097050 [exp]	1.00	0.9652
AT1G79510			Uncharacterized conserved prot...		Potri.010G173000 [exp]	3.87	0.9525
AT5G38260			Protein kinase superfamily pro...		Potri.007G125450 [exp]	4.24	0.9575
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Potri.006G087200 [exp]	5.91	0.9481	Pt-DFR1.3
AT5G01540		LECRKA4.1	lectin receptor kinase a4.1 (....		Potri.016G123501 [exp]	6.32	0.9364
AT2G29100		ATGLR2.9	GLUTAMATE RECEPTOR 2.9, gluta...		Potri.004G052600 [exp]	6.63	0.9493
AT3G60690			SAUR-like auxin-responsive pro...		Potri.014G066900 [exp]	7.41	0.9325
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.002G028700 [exp]	7.48	0.9378	VFCYSPRO.1
AT3G18560			unknown protein		Potri.017G128700 [exp]	7.61	0.8958
AT2G17880			Chaperone DnaJ-domain superfam...		Potri.005G113100 [exp]	8.24	0.8925

Compare expression of checked genes

Potri.013G098100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.