Plant FIBer expression Database

Potri.013G098625 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10890 52 / 2e-09 Glycosyl hydrolase superfamily protein (.1)
AT5G66460 50 / 1e-08 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
AT3G10900 49 / 3e-08 Glycosyl hydrolase superfamily protein (.1)
AT1G02310 46 / 3e-07 MAN1 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1)
AT5G01930 46 / 5e-07 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
AT4G28320 42 / 9e-06 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1)
AT2G20680 40 / 6e-05 MAN2, AtMAN2 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G229600
[exp]
55 / 3e-10 AT5G66460 542 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.002G184500
[exp]
54 / 8e-10 AT5G66460 447 / 5e-156 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.007G022000
[exp]
52 / 3e-09 AT5G66460 573 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.005G120500
[exp]
50 / 1e-08 AT5G66460 588 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.016G138600
[exp]
44 / 2e-06 AT5G01930 683 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Potri.006G009400
[exp]
43 / 5e-06 AT4G28320 430 / 2e-148 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1)
Potri.006G109900
[exp]
42 / 9e-06 AT5G01930 659 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Potri.013G130400
[exp]
40 / 4e-05 AT2G20680 661 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Potri.019G070200
[exp]
0 / 1 AT3G10890 302 / 3e-100 Glycosyl hydrolase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030347
[exp]
57 / 8e-11 AT5G66460 422 / 2e-145 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10007900
[exp]
56 / 1e-10 AT5G66460 417 / 4e-143 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10025995
[exp]
50 / 2e-08 AT5G66460 577 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10014288
[exp]
48 / 8e-08 AT5G66460 583 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10007211
[exp]
48 / 9e-08 AT1G02310 405 / 4e-134 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1)
Lus10027329
[exp]
48 / 9e-08 AT2G20680 438 / 8e-152 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Lus10039032
[exp]
48 / 1e-07 AT2G20680 433 / 8e-150 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Lus10007210
[exp]
46 / 4e-07 AT5G66460 401 / 5e-138 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10022729
[exp]
45 / 7e-07 AT5G01930 276 / 4e-92 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Lus10014184
[exp]
44 / 2e-06 AT5G01930 674 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.013G098625.1 pacid=42811008 polypeptide=Potri.013G098625.1.p locus=Potri.013G098625 ID=Potri.013G098625.1.v4.1 annot-version=v4.1
ATGATGAATGTTGCTGCGCGGCCAAGTCCATGGTACAGATATCCAATATCTTTCGCTAGGCTGCTGCTGCAGGTCTCACTGTCTCTCGAACATGGGCATT
TAGCGATGGAGTTGATCAAGCTCTGCAGGTTTCTCCGTGGGTTTATAGCGGGCCTGTCTTTTCAGGGACTTGATTTCGTTATTCCTGAGGCAAGAAAGTA
CGGAATTCGCTTGATCTTGACATTAAGAAACAATCACCATGACTTTGGAGGACGACGATCATAG
AA sequence
>Potri.013G098625.1 pacid=42811008 polypeptide=Potri.013G098625.1.p locus=Potri.013G098625 ID=Potri.013G098625.1.v4.1 annot-version=v4.1
MMNVAARPSPWYRYPISFARLLLQVSLSLEHGHLAMELIKLCRFLRGFIAGLSFQGLDFVIPEARKYGIRLILTLRNNHHDFGGRRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G66460 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl ... Potri.013G098625
[exp]
0 1

Potri.013G098625 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.