Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39230 96 / 6e-25 NmrA-like negative transcriptional regulator family protein (.1) AT1G75290 92 / 3e-23 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G75280 92 / 3e-23 NmrA-like negative transcriptional regulator family protein (.1) AT1G19540 87 / 3e-21 NmrA-like negative transcriptional regulator family protein (.1) AT1G75300 85 / 1e-20 NmrA-like negative transcriptional regulator family protein (.1) AT1G32100 82 / 2e-19 ATPRR1 pinoresinol reductase 1 (.1) AT4G34540 75 / 5e-17 NmrA-like negative transcriptional regulator family protein (.1) AT4G13660 72 / 7e-16 ATPRR2 pinoresinol reductase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G103850 [exp] 246 / 2e-83 AT1G75280 272 / 2e-90 NmrA-like negative transcriptional regulator family protein (.1) Potri.013G103701 [exp] 246 / 3e-83 AT1G75280 271 / 4e-90 NmrA-like negative transcriptional regulator family protein (.1) Potri.019G078100 [exp] 184 / 3e-60 AT1G75280 169 / 9e-52 NmrA-like negative transcriptional regulator family protein (.1) Potri.007G123700 [exp] 164 / 3e-51 AT1G75280 284 / 4e-95 NmrA-like negative transcriptional regulator family protein (.1) Potri.009G118100 [exp] 105 / 1e-28 AT4G39230 501 / 0.0 NmrA-like negative transcriptional regulator family protein (.1) Potri.007G036500 [exp] 105 / 2e-28 AT4G39230 407 / 1e-143 NmrA-like negative transcriptional regulator family protein (.1) Potri.011G168400 [exp] 100 / 4e-26 AT4G39230 448 / 2e-159 NmrA-like negative transcriptional regulator family protein (.1) Potri.009G118300 [exp] 99 / 5e-26 AT4G39230 488 / 8e-176 NmrA-like negative transcriptional regulator family protein (.1) Potri.002G034400 [exp] 96 / 9e-25 AT1G75280 467 / 2e-167 NmrA-like negative transcriptional regulator family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026350 [exp] 102 / 5e-27 AT4G39230 454 / 3e-162 NmrA-like negative transcriptional regulator family protein (.1) Lus10042313 [exp] 97 / 2e-25 AT4G39230 369 / 2e-129 NmrA-like negative transcriptional regulator family protein (.1) Lus10042311 [exp] 96 / 7e-25 AT4G39230 489 / 4e-176 NmrA-like negative transcriptional regulator family protein (.1) Lus10026348 [exp] 96 / 1e-24 AT4G39230 442 / 2e-157 NmrA-like negative transcriptional regulator family protein (.1) Lus10026351 [exp] 91 / 9e-23 AT4G39230 481 / 4e-173 NmrA-like negative transcriptional regulator family protein (.1) Lus10040442 [exp] 90 / 1e-22 AT4G39230 462 / 2e-165 NmrA-like negative transcriptional regulator family protein (.1) Lus10042312 [exp] 88 / 4e-22 AT4G39230 253 / 1e-83 NmrA-like negative transcriptional regulator family protein (.1) Lus10023557 [exp] 90 / 8e-22 AT4G39230 461 / 2e-162 NmrA-like negative transcriptional regulator family protein (.1) Lus10042968 [exp] 83 / 3e-20 AT1G75280 100 / 2e-24 NmrA-like negative transcriptional regulator family protein (.1) Lus10032470 [exp] 83 / 1e-19 AT1G75290 226 / 2e-71 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF05368 [poplar] [flax] NmrA NmrA-like family
Representative CDS sequence Show only first row Show all	>Potri.013G104000.2 pacid=42811168 polypeptide=Potri.013G104000.2.p locus=Potri.013G104000 ID=Potri.013G104000.2.v4.1 annot-version=v4.1 ATGTACACCATCAAAATAGCTGATGACCCCGAAACATACAATCGAGTTTTAATCTATCGGCCGCAGAAGAACATTGTATCTCAGCTTGAACTTATTTCCC TTTGGGAGAAGAAGACTGGAAAGACTTTTAATAGGATTCACGTCCCTGAGGATGAAATAGTGAAGCTCTCTGAAACCCTTCTACATCCACAAAATATTCC AGTTTCTATTCTTCACAGTCTGTTCGTGAAGGGTGACATGATGGGGTTTGAACTGGGAGAGGATGACTTGGAGGCTTCTGGGCTATATCCAGACCTGGAA TTTAGAACAATCGATCAACTTCTTGATATTTTTCTCACTAGCCCTCCAGATCCTGCAGCTGCTGCTTTTGAATGA
AA sequence Show only first row Show all	>Potri.013G104000.2 pacid=42811168 polypeptide=Potri.013G104000.2.p locus=Potri.013G104000 ID=Potri.013G104000.2.v4.1 annot-version=v4.1 MYTIKIADDPETYNRVLIYRPQKNIVSQLELISLWEKKTGKTFNRIHVPEDEIVKLSETLLHPQNIPVSILHSLFVKGDMMGFELGEDDLEASGLYPDLE FRTIDQLLDIFLTSPPDPAAAAFE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39230			NmrA-like negative transcripti...		Potri.013G104000 [exp]	0	1
AT3G63410		VTE3, APG1, IEP...	VITAMIN E DEFECTIVE 3, INNER E...		Potri.008G159400 [exp]	1.41	0.9800	Pt-APG1.1
AT4G14890		FdC2	ferredoxin C 2, 2Fe-2S ferredo...		Potri.010G087300 [exp]	2.82	0.9821
AT3G01500		SABP3, ATBCA1, ...	ARABIDOPSIS THALIANA SALICYLIC...		Potri.001G348900 [exp]	2.82	0.9775	CA1.3
AT1G58684			Ribosomal protein S5 family pr...		Potri.001G256800 [exp]	3.87	0.9798
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Potri.003G020400 [exp]	4.47	0.9770
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Potri.011G126700 [exp]	5.91	0.9749
AT3G26060		ATPRXQ ,ATPRX Q	peroxiredoxin Q, Thioredoxin s...		Potri.006G137500 [exp]	7.74	0.9676	Pt-PRXQ.1
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.004G155866 [exp]	7.74	0.9765
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Potri.001G407100 [exp]	8.48	0.9746	Lhcb3-1,LHCB3.2
AT5G04590		SIR	sulfite reductase (.1)		Potri.009G052600 [exp]	8.94	0.9696

Compare expression of checked genes

Potri.013G104000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.