Potri.013G104501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G077500 56 / 5e-10 AT1G33980 321 / 3e-104 Smg-4/UPF3 family protein (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.013G104501.1 pacid=42811301 polypeptide=Potri.013G104501.1.p locus=Potri.013G104501 ID=Potri.013G104501.1.v4.1 annot-version=v4.1
ATGCTCGCTTTCTTTAAATGTGGCCAAATGTTCCATTTCTTTAACTATTGGTTAACAACGAGGATTTATTTGCTTAAGAAATTTGTGCTTAAAGAGCTCT
CAGAGGCTACAAAAGAAACTCCTATTTCTATTTCTACACCCTTGATGGAATTTGTTCGTCAGAAACGAGCTGATAAGGGTGGAAACAAGGGTTCGGCTGT
TGTTAAGGGTGGGAAAAGAGCTGGGTCAGCATCTCCGACCAATTCTGGTTCAAGTAGTACCAAACGAGGCTCTGCTACGAAGAAGGTTTTTTCCAGAATT
ATAGCCACAATCTGTTTCAAGCAAACGTTATCAGTGTTAGGAATTAAATGTGCTTGTTGTACCTTGTTTTTCTGTCATGATTTAGTCTGCAGTTAA
AA sequence
>Potri.013G104501.1 pacid=42811301 polypeptide=Potri.013G104501.1.p locus=Potri.013G104501 ID=Potri.013G104501.1.v4.1 annot-version=v4.1
MLAFFKCGQMFHFFNYWLTTRIYLLKKFVLKELSEATKETPISISTPLMEFVRQKRADKGGNKGSAVVKGGKRAGSASPTNSGSSSTKRGSATKKVFSRI
IATICFKQTLSVLGIKCACCTLFFCHDLVCS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G104501 0 1
AT4G16447 unknown protein Potri.011G086300 5.47 0.9216
AT4G30380 EXLB2 Barwin-related endoglucanase (... Potri.003G218300 7.34 0.8058
AT4G38040 Exostosin family protein (.1) Potri.012G024150 7.48 0.6064
AT1G09060 Zinc finger, RING-type;Transcr... Potri.005G026950 9.38 0.7019
AT1G22110 structural constituent of ribo... Potri.005G169900 10.00 0.7227
AT1G61566 RALFL9 ralf-like 9 (.1) Potri.018G007701 10.39 0.6902
AT4G27790 Calcium-binding EF hand family... Potri.015G010300 11.66 0.5907
AT2G35110 NAPP, GRL, NAP1 NCK-ASSOCIATED PROTEIN 1, GNAR... Potri.015G123001 14.00 0.5050
AT1G54560 PCR1, ATXIE, XI... MYOSIN XI E, Myosin family pro... Potri.019G013800 17.29 0.5478
AT1G34065 SAMC2 S-adenosylmethionine carrier 2... Potri.002G063901 20.00 0.5615

Potri.013G104501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.