Potri.013G105400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72175 264 / 4e-91 RING/U-box protein with domain of unknown function (DUF 1232) (.1)
AT1G22510 234 / 2e-79 RING/U-box protein with domain of unknown function (DUF 1232) (.1), RING/U-box protein with domain of unknown function (DUF 1232) (.2)
AT4G33940 140 / 2e-41 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G078800 302 / 2e-106 AT1G72175 259 / 3e-89 RING/U-box protein with domain of unknown function (DUF 1232) (.1)
Potri.004G143900 134 / 4e-39 AT4G33940 221 / 2e-72 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009529 277 / 2e-96 AT1G72175 261 / 5e-90 RING/U-box protein with domain of unknown function (DUF 1232) (.1)
Lus10020349 277 / 4e-96 AT1G72175 261 / 8e-90 RING/U-box protein with domain of unknown function (DUF 1232) (.1)
Lus10027921 152 / 2e-46 AT4G33940 251 / 3e-84 RING/U-box superfamily protein (.1)
Lus10012062 149 / 3e-45 AT4G33940 252 / 2e-84 RING/U-box superfamily protein (.1)
Lus10014366 137 / 1e-38 AT4G33940 189 / 2e-57 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.013G105400.1 pacid=42810892 polypeptide=Potri.013G105400.1.p locus=Potri.013G105400 ID=Potri.013G105400.1.v4.1 annot-version=v4.1
ATGGATGGACCTCCAGGGAACGATTGTTGCGCCATATGCCATGGACACTTCAACATTGCTTGTCAGGCCAATTGCTCTCATTGGTTTTGCGGTGATTGTA
TTATGCTTGTTTGGCATCATGGATCTGTACTCCAGCCATGTAAATGTCCGCTGTGTCGTCGACAGATTACATTGTTGGTTCCTGGTGAAGCTTCATTAAG
GGAGCGCAATGATCCTCATGTTGCTGAGGTTCTTGGAAAAATTGAAAGATACAATCATCTTTTTGGTGGAAATACCAGTAGTCTTGTTCAGAGAATGCAA
GACCTTCCATTTCTTCTCCGGAGGTTGTTGCGAGAAATAATGGATCCCCAAAGATCTCTTCCTGTGGTCATCAAGGCACGTGTCTACATTGCAATGGTAT
TAAGTGCTGTCTACATCATCAGCCCTGTAGACATTATTCCAGAAGGAATTTTGGGAATAGTTGGTCTCTTGGATGATCTCCTCATAGTGCTCATCTGCTT
TCTTCATGTTGCTGCCATCTACCGGTCAGTGCTCTATTATCGTCATGGAGGTTCTTGA
AA sequence
>Potri.013G105400.1 pacid=42810892 polypeptide=Potri.013G105400.1.p locus=Potri.013G105400 ID=Potri.013G105400.1.v4.1 annot-version=v4.1
MDGPPGNDCCAICHGHFNIACQANCSHWFCGDCIMLVWHHGSVLQPCKCPLCRRQITLLVPGEASLRERNDPHVAEVLGKIERYNHLFGGNTSSLVQRMQ
DLPFLLRRLLREIMDPQRSLPVVIKARVYIAMVLSAVYIISPVDIIPEGILGIVGLLDDLLIVLICFLHVAAIYRSVLYYRHGGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G72175 RING/U-box protein with domain... Potri.013G105400 0 1
Potri.001G129500 3.46 0.7952
AT1G80500 SNARE-like superfamily protein... Potri.001G043400 5.47 0.8007
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.001G236700 6.78 0.8293 ADF1,Pt-ADF.5
AT3G53000 ATPP2-A15 phloem protein 2-A15 (.1) Potri.006G117600 8.83 0.7640
AT1G49245 Prefoldin chaperone subunit fa... Potri.013G072700 11.22 0.7435
AT1G79440 ENF1, SSADH1, A... SUCCINIC SEMIALDEHYDE DEHYDROG... Potri.010G174000 12.88 0.6891 Pt-ALDH5.2
AT5G38630 ACYB-1 cytochrome B561-1 (.1) Potri.008G115300 18.89 0.7539
AT1G74520 ATHVA22A HVA22 homologue A (.1) Potri.015G062800 18.97 0.8015
AT4G00752 UBX domain-containing protein ... Potri.014G075600 20.49 0.7911
AT5G20165 unknown protein Potri.010G058300 20.78 0.8016

Potri.013G105400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.