Potri.013G107650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.013G107650.1 pacid=42812468 polypeptide=Potri.013G107650.1.p locus=Potri.013G107650 ID=Potri.013G107650.1.v4.1 annot-version=v4.1
ATGAGGCGCTTAATTTTGGAGTACGAAGACAGGAACATGAGTGGGGATAGAGGCAGATTCTGGTGGGCACATTTTAACATTTGCGAGCTTACTAAGTGCA
GGGTCTTGATTTTCTTCGATGGGGAGAGAAAGAGGCTGTGTTTCTTGGTGTTAGTCTTCCTATGCAATTATGATGTGGGGACTGGCTTCATGAAGATGAA
GATAACGCCTAGGTTCGAGCCTTATGATTACTCATATGATAGTCACTGA
AA sequence
>Potri.013G107650.1 pacid=42812468 polypeptide=Potri.013G107650.1.p locus=Potri.013G107650 ID=Potri.013G107650.1.v4.1 annot-version=v4.1
MRRLILEYEDRNMSGDRGRFWWAHFNICELTKCRVLIFFDGERKRLCFLVLVFLCNYDVGTGFMKMKITPRFEPYDYSYDSH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G107650 0 1
Potri.018G096021 4.35 0.9018
Potri.018G096014 9.32 0.8656
AT2G47350 HIT zinc finger ;PAPA-1-like c... Potri.002G195066 11.53 0.8555
Potri.019G059350 12.44 0.8566
Potri.001G063309 13.19 0.8565
AT1G48620 HON5 high mobility group A5 (.1) Potri.015G040200 19.33 0.7915
Potri.012G052502 19.49 0.8441
Potri.005G096266 20.97 0.8401
AT5G63540 BLAP75, ATRMI1 RECQ MEDIATED INSTABILITY 1, D... Potri.015G100200 21.35 0.7968
AT5G11550 ARM repeat superfamily protein... Potri.006G240400 23.08 0.7541

Potri.013G107650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.