Potri.013G108700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G20230 226 / 5e-76 Ribosomal L18p/L5e family protein (.1)
AT1G08845 111 / 4e-31 Ribosomal L18p/L5e family protein (.1.2)
AT5G27820 72 / 2e-16 Ribosomal L18p/L5e family protein (.1)
AT3G22450 74 / 9e-16 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G081000 277 / 6e-96 AT3G20230 249 / 4e-85 Ribosomal L18p/L5e family protein (.1)
Potri.013G029300 118 / 1e-33 AT1G08845 295 / 1e-102 Ribosomal L18p/L5e family protein (.1.2)
Potri.008G153100 94 / 6e-23 AT3G22450 253 / 2e-82 Ribosomal L18p/L5e family protein (.1)
Potri.007G100900 65 / 1e-13 AT5G27820 155 / 3e-50 Ribosomal L18p/L5e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020797 237 / 5e-80 AT3G20230 238 / 1e-80 Ribosomal L18p/L5e family protein (.1)
Lus10007379 236 / 5e-80 AT3G20230 234 / 3e-79 Ribosomal L18p/L5e family protein (.1)
Lus10001727 116 / 5e-33 AT1G08845 268 / 1e-92 Ribosomal L18p/L5e family protein (.1.2)
Lus10004129 115 / 1e-29 AT5G27240 265 / 4e-82 DNAJ heat shock N-terminal domain-containing protein (.1)
Lus10010558 98 / 2e-24 AT3G22450 238 / 8e-77 Ribosomal L18p/L5e family protein (.1)
Lus10006115 98 / 2e-24 AT3G22450 231 / 6e-74 Ribosomal L18p/L5e family protein (.1)
Lus10031487 67 / 2e-14 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
Lus10015194 67 / 2e-14 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Potri.013G108700.1 pacid=42810798 polypeptide=Potri.013G108700.1.p locus=Potri.013G108700 ID=Potri.013G108700.1.v4.1 annot-version=v4.1
ATGGCCTGCATAATATCTTCTTCTGCAGCTCTTTCAACTCGGTCACTTCTCTCCACGGACTCAATCCCAACTCAATCATCTCGCTCAATCAAACCCAATT
CAATCTCATGGGTCTCTTCGTTTCCCTCTATAAACATCTCAATCAACAACAACCCATCCTCACTCAACAAGAATTCTTTCATTCAAGCTGCGTGGACCAG
AAGATCTCGAGGTGAACTTGAGAAGAAACCTAACAAAAAATCTTGGAAACAGAGGACAGAAATGTATATGAAGCCATTCTTACTAAATGTTTTCTTTTCA
AGGAAATTTATTCAGGCAAAAGTGATGCACCGAGGAACAAGTAAAGTGATATCAGTTGCTACTACAAATGCCAAGGATCTTAGACACAGTTTACCATCAC
TCACAGATCACAATGCCTGTAGAATTGTAGGGAAGCTTATTGCTGAGAGATCCAAGGAAGCTGATGTGTATGCAATGTCATATGAACCTCGAAAGGATGA
GCGGATTGAAGGTAAACTTGGAATTGTTATTGATACTATTAAGGAGAATGGGATCATATTTGTTTGA
AA sequence
>Potri.013G108700.1 pacid=42810798 polypeptide=Potri.013G108700.1.p locus=Potri.013G108700 ID=Potri.013G108700.1.v4.1 annot-version=v4.1
MACIISSSAALSTRSLLSTDSIPTQSSRSIKPNSISWVSSFPSINISINNNPSSLNKNSFIQAAWTRRSRGELEKKPNKKSWKQRTEMYMKPFLLNVFFS
RKFIQAKVMHRGTSKVISVATTNAKDLRHSLPSLTDHNACRIVGKLIAERSKEADVYAMSYEPRKDERIEGKLGIVIDTIKENGIIFV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G20230 Ribosomal L18p/L5e family prot... Potri.013G108700 0 1
AT4G09650 PDE332, ATPD PIGMENT DEFECTIVE 332, ATP syn... Potri.014G102100 1.00 0.9850
AT3G62410 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN... Potri.014G120700 2.00 0.9847
AT2G04530 CPZ, TRZ2 TRNASE Z 2, Metallo-hydrolase/... Potri.014G160600 4.24 0.9809
AT1G10500 ATCPISCA chloroplast-localized ISCA-lik... Potri.005G085400 4.89 0.9744
AT2G43950 OEP37, ATOEP37 ARABIDOPSIS CHLOROPLAST OUTER ... Potri.017G007300 6.32 0.9758
AT2G22360 DNAJ heat shock family protein... Potri.005G073900 6.92 0.9759
AT3G04550 unknown protein Potri.013G044900 6.92 0.9749
AT4G14870 SECE1 secE/sec61-gamma protein trans... Potri.008G153400 7.07 0.9721
AT3G17170 RFC3 REGULATOR OF FATTY-ACID COMPOS... Potri.008G101900 7.34 0.9727 Pt-RFC3.1
AT2G41950 unknown protein Potri.006G194600 8.00 0.9703

Potri.013G108700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.