Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G51660 45 / 6e-06 ATMKK4, ATMEK4 ARABIDOPSIS THALIANA MITOGEN-ACTIVATED PROTEIN KINASE KINASE 4, mitogen-activated protein kinase kinase 4 (.1) AT4G31170 45 / 7e-06 Protein kinase superfamily protein (.1.2.3.4) AT3G59410 45 / 8e-06 ATGCN2, GCN2 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 2, protein kinase family protein (.1.2) AT4G08470 45 / 1e-05 MEKK3, MAPKKK10 MAPK/ERK kinase kinase 3 (.1) AT3G21220 44 / 2e-05 ATMAP2K_ALPHA, ATMKK5, ATMEK5 ARABIDOPSIS THALIANA MITOGEN-ACTIVATED PROTEIN KINASE KINASE 5, MAP kinase kinase 5 (.1) AT5G64960 44 / 2e-05 CDKC2, CDKC;2 Cyclin-dependent kinase C;2, cyclin dependent kinase group C2 (.1.2) AT3G06230 44 / 2e-05 ATMKK8 MAP kinase kinase 8 (.1) AT2G24360 44 / 2e-05 Protein kinase superfamily protein (.1) AT4G08500 44 / 2e-05 ARAKIN, ATMEKK1, MAPKKK8, MEKK1 MAPK/ERK kinase kinase 1 (.1) AT5G10270 44 / 3e-05 CDKC;1 cyclin-dependent kinase C;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G003700 [exp] 49 / 5e-07 AT5G10270 661 / 0.0 cyclin-dependent kinase C;1 (.1) Potri.007G128300 [exp] 46 / 3e-06 AT3G59410 1610 / 0.0 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 2, protein kinase family protein (.1.2) Potri.006G024600 [exp] 46 / 3e-06 AT5G10270 712 / 0.0 cyclin-dependent kinase C;1 (.1) Potri.008G009800 [exp] 44 / 2e-05 AT3G21220 474 / 9e-169 ARABIDOPSIS THALIANA MITOGEN-ACTIVATED PROTEIN KINASE KINASE 5, MAP kinase kinase 5 (.1) Potri.012G094600 [exp] 44 / 2e-05 AT1G67580 574 / 0.0 Protein kinase superfamily protein (.1.2) Potri.013G035900 [exp] 44 / 2e-05 AT3G23750 1044 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G279900 [exp] 44 / 2e-05 AT2G24360 642 / 0.0 Protein kinase superfamily protein (.1) Potri.006G147800 [exp] 44 / 3e-05 AT1G72710 674 / 0.0 casein kinase 1-like protein 2 (.1) Potri.018G001800 [exp] 44 / 3e-05 AT2G24360 663 / 0.0 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026790 [exp] 47 / 3e-06 AT5G10270 675 / 0.0 cyclin-dependent kinase C;1 (.1) Lus10036106 [exp] 47 / 3e-06 AT5G10270 689 / 0.0 cyclin-dependent kinase C;1 (.1) Lus10042588 [exp] 45 / 1e-05 AT5G10270 712 / 0.0 cyclin-dependent kinase C;1 (.1) Lus10014896 [exp] 45 / 1e-05 AT3G59410 517 / 2e-173 ARABIDOPSIS THALIANA GENERAL CONTROL NON-REPRESSIBLE 2, protein kinase family protein (.1.2) Lus10022043 [exp] 45 / 1e-05 AT5G10270 710 / 0.0 cyclin-dependent kinase C;1 (.1) Lus10041845 [exp] 44 / 2e-05 AT4G35780 791 / 0.0 serine/threonine/tyrosine kinase 17, ACT-like protein tyrosine kinase family protein (.1) Lus10001081 [exp] 42 / 6e-05 AT1G73500 296 / 2e-101 MAP kinase kinase 9 (.1) Lus10035764 [exp] 42 / 7e-05 AT1G51660 500 / 7e-179 ARABIDOPSIS THALIANA MITOGEN-ACTIVATED PROTEIN KINASE KINASE 4, mitogen-activated protein kinase kinase 4 (.1) Lus10006879 [exp] 42 / 7e-05 AT1G72710 664 / 0.0 casein kinase 1-like protein 2 (.1) Lus10037621 [exp] 42 / 7e-05 AT1G72710 655 / 0.0 casein kinase 1-like protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.013G110450.1 pacid=42811552 polypeptide=Potri.013G110450.1.p locus=Potri.013G110450 ID=Potri.013G110450.1.v4.1 annot-version=v4.1 ATGCATGTCATGAAGAGTTGTTTATACAGATGGAGTGCTGTCCAATGTGAGACTTTTCATGATCTGCTTTCTACAAAGACTAATCTCAAAAGACGCATCT TGATGGCCAGACAAATTGTTGAAGGATTACGCTTCATCCATACAAATCAATTTGTTCACAGAGACCTTGCCACAAAATACATTTTTGTGGGAGCTTTCCA GGACGAGAAGGAGATCAAAATAGAAGATTTCGGAATTAGTGAACAGTTTAAATTTGAATGTGAATCTAACTTGATCAATCTTAGCTTTTATTGTTCCAAG TTGATTGTTTATTTCTTATTAATATTTTTTTGGCAACGGTATTATGTAAGAAAAGTGAAAAAATTCAAGTTGACGCTCAAGGAAACAAAAGTTAAGAGGC TCCTGAGGGAAAAGGACCCATCGATGCAAAAGCAGATATATACAGTTTGTGAATTATTGTGTTCATGCTGCTGCACCCTCACAATATCCGGCACAGAAAG AAAATAG
AA sequence Show only first row Show all	>Potri.013G110450.1 pacid=42811552 polypeptide=Potri.013G110450.1.p locus=Potri.013G110450 ID=Potri.013G110450.1.v4.1 annot-version=v4.1 MHVMKSCLYRWSAVQCETFHDLLSTKTNLKRRILMARQIVEGLRFIHTNQFVHRDLATKYIFVGAFQDEKEIKIEDFGISEQFKFECESNLINLSFYCSK LIVYFLLIFFWQRYYVRKVKKFKLTLKETKVKRLLREKDPSMQKQIYTVCELLCSCCCTLTISGTERK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G51660		ATMKK4, ATMEK4	ARABIDOPSIS THALIANA MITOGEN-A...		Potri.013G110450 [exp]	0	1
AT3G23200			Uncharacterised protein family...		Potri.010G073000 [exp]	6.00	0.7383
AT5G28910			unknown protein		Potri.019G019800 [exp]	10.95	0.7267
AT3G55260		HEXO1, ATHEX2	beta-hexosaminidase 1 (.1)		Potri.010G211000 [exp]	11.61	0.7429
AT5G44740		POLH	Y-family DNA polymerase H (.1....		Potri.003G152600 [exp]	12.44	0.7601
AT2G22830		SQE2	squalene epoxidase 2 (.1)		Potri.015G121201 [exp]	12.80	0.6507
AT3G54020		AtIPCS1	Arabidopsis Inositol phosphory...		Potri.001G246300 [exp]	18.33	0.7116
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Potri.002G147702 [exp]	21.21	0.6831
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Potri.018G086800 [exp]	22.04	0.6817
AT2G45630			D-isomer specific 2-hydroxyaci...		Potri.014G073600 [exp]	22.60	0.7131
AT1G72175			RING/U-box protein with domain...		Potri.019G078800 [exp]	23.36	0.6868

Compare expression of checked genes

Potri.013G110450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.