Potri.013G113000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09580 454 / 4e-163 SNARE associated Golgi protein family (.1)
AT1G71940 452 / 9e-163 SNARE associated Golgi protein family (.1.2)
AT4G17790 333 / 1e-115 SNARE associated Golgi protein family (.1)
AT1G03260 54 / 2e-08 SNARE associated Golgi protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G083500 539 / 0 AT1G71940 460 / 1e-165 SNARE associated Golgi protein family (.1.2)
Potri.003G094000 339 / 2e-118 AT4G17790 378 / 8e-134 SNARE associated Golgi protein family (.1)
Potri.001G140200 333 / 7e-116 AT4G17790 379 / 2e-134 SNARE associated Golgi protein family (.1)
Potri.010G030800 42 / 0.0002 AT5G19070 321 / 7e-111 SNARE associated Golgi protein family (.1)
Potri.008G202600 42 / 0.0002 AT5G19070 338 / 1e-117 SNARE associated Golgi protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017913 479 / 5e-173 AT4G09580 442 / 2e-158 SNARE associated Golgi protein family (.1)
Lus10014818 406 / 9e-145 AT1G71940 374 / 2e-132 SNARE associated Golgi protein family (.1.2)
Lus10004564 334 / 5e-116 AT4G17790 388 / 1e-137 SNARE associated Golgi protein family (.1)
Lus10000905 332 / 3e-115 AT4G17790 387 / 2e-137 SNARE associated Golgi protein family (.1)
Lus10034028 47 / 5e-06 AT5G19070 363 / 3e-127 SNARE associated Golgi protein family (.1)
Lus10004421 47 / 1e-05 AT5G19070 361 / 2e-126 SNARE associated Golgi protein family (.1)
Lus10028016 46 / 1e-05 AT1G03260 328 / 2e-113 SNARE associated Golgi protein family (.1)
Lus10021942 40 / 0.0008 AT5G19070 343 / 9e-120 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Potri.013G113000.1 pacid=42812667 polypeptide=Potri.013G113000.1.p locus=Potri.013G113000 ID=Potri.013G113000.1.v4.1 annot-version=v4.1
ATGGCATCAGCAAGGAATCTAGTAGTTGAAATAGCAGCAGGAAACGAGAGAGGGAAGGTGTTAACGATGAGAGATGAAGAGAAAGCTAAAGAGGACGATT
CACCCTCTGCTAAAAGGTCGAAATTTGAGAGATTTCCATTGACAAGATGGGAATTAGCTGCTGCTCTTGGGGTCTTTTTAGTCTTTTCAACTGGTTTGTT
TTGTATCTACTTGACAATGCCTGCTGCTGATTATGGCAAGCTCAAGTTGCCTCGTTCTATTTCAGATCTTCGCTTGCTCAAAGACAATCTTGCAACATAT
GTGAGTGAATATCCAGCACAGTTCATTCTGGGCTACTGCTCTACTTATATCTTCATGCAGACCTTCATGATTCCTGGAACAATTTTCATGTCATTACTAG
CTGGAGCTCTTTTTGGCATTGTTAGGGGACTATTTTTAGTTGTCTTCAATGCCACAGCTGGAGCGTCTTCCTGCTTTTTCTTGTCTAAGTTGATTGGCAG
GCCTCTAGTTAATTGGTTGTGGCCTGAAAAAATGAGATTTTTTCAGTCAGAGATTGCTAAGCGAAAGGAAAAACTGCTGAATTACATGCTCTTCTTGAGA
GTAACTCCAACGTTGCCCAATCTTTTTATCAATTTGGCATCTCCAATAGTGGACATACCATTTCATATTTTCTTTTTGGCTACTTTACTAGGTCTTATTC
CTGCTTCCTATATCACTGTCAAGGCTGGCCTTGCTCTAGGGGATCTCAAGTCAGTTAAGGATCTATATGATTTCAAAACTTTGTCTGTGCTCTTCCTTAT
TGGATCCATTTCCATATTTCCTACCCTTTTAAAGAGAAAGCGGATATATGAGTGA
AA sequence
>Potri.013G113000.1 pacid=42812667 polypeptide=Potri.013G113000.1.p locus=Potri.013G113000 ID=Potri.013G113000.1.v4.1 annot-version=v4.1
MASARNLVVEIAAGNERGKVLTMRDEEKAKEDDSPSAKRSKFERFPLTRWELAAALGVFLVFSTGLFCIYLTMPAADYGKLKLPRSISDLRLLKDNLATY
VSEYPAQFILGYCSTYIFMQTFMIPGTIFMSLLAGALFGIVRGLFLVVFNATAGASSCFFLSKLIGRPLVNWLWPEKMRFFQSEIAKRKEKLLNYMLFLR
VTPTLPNLFINLASPIVDIPFHIFFLATLLGLIPASYITVKAGLALGDLKSVKDLYDFKTLSVLFLIGSISIFPTLLKRKRIYE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G09580 SNARE associated Golgi protein... Potri.013G113000 0 1
AT3G06240 F-box family protein (.1) Potri.001G318300 3.74 0.6520
AT3G61140 EMB78, CSN1, CO... EMBRYO DEFECTIVE 78, COP9 SIGN... Potri.002G154500 5.83 0.6719 EMB78.2
AT1G72810 Pyridoxal-5'-phosphate-depende... Potri.001G199100 9.16 0.6142
AT5G44370 PHT4;6 phosphate transporter 4;6 (.1) Potri.009G168200 11.31 0.6038
AT4G29960 unknown protein Potri.006G075900 12.12 0.5866
AT1G18580 GAUT11 galacturonosyltransferase 11 (... Potri.015G060800 12.48 0.5489
AT3G02090 MPPBETA Insulinase (Peptidase family M... Potri.004G118900 19.74 0.5962
AT2G17200 DSK2 ubiquitin family protein (.1) Potri.009G166000 22.36 0.5355
AT3G09880 ATB' BETA, ATB'... Protein phosphatase 2A regulat... Potri.016G098400 24.81 0.5008 Pt-ATB'.2
AT5G05987 PRA1.A2 prenylated RAB acceptor 1.A2 (... Potri.010G198000 26.66 0.5726

Potri.013G113000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.