Potri.013G113400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18420 96 / 1e-27 Gibberellin-regulated family protein (.1)
AT4G09600 92 / 5e-26 GASA3 GAST1 protein homolog 3 (.1)
AT1G75750 87 / 9e-24 GASA1 GAST1 protein homolog 1 (.1.2)
AT1G22690 83 / 3e-22 Gibberellin-regulated family protein (.1.2.3)
AT2G39540 81 / 2e-21 Gibberellin-regulated family protein (.1)
AT1G10588 79 / 7e-21 Gibberellin-regulated family protein (.1.2)
AT4G09610 76 / 1e-19 GASA2 GAST1 protein homolog 2 (.1)
AT5G59845 73 / 3e-18 Gibberellin-regulated family protein (.1)
AT1G74670 70 / 3e-17 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT5G14920 73 / 7e-17 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G239100 99 / 2e-28 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.005G239000 96 / 1e-27 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.002G022500 92 / 7e-26 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.002G022600 90 / 7e-25 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022700 86 / 3e-23 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.019G083900 77 / 5e-20 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.015G071500 77 / 1e-19 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.012G076700 76 / 2e-19 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.017G124200 72 / 3e-18 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034524 99 / 3e-28 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10033145 94 / 3e-26 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10017212 92 / 7e-26 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10009421 84 / 7e-22 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10025962 77 / 9e-20 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10014262 74 / 1e-18 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10029340 72 / 6e-18 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1)
Lus10018708 69 / 7e-17 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1)
Lus10001407 69 / 1e-16 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1)
Lus10002059 67 / 8e-16 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.013G113400.3 pacid=42810914 polypeptide=Potri.013G113400.3.p locus=Potri.013G113400 ID=Potri.013G113400.3.v4.1 annot-version=v4.1
ATGGTCAGTGCCAAGACAACATTTATCTTGGCAATACTTTGCCTGGCCCTAATGCATGAGCTTCAGATCCGTACTGTTGAAGCTGGGAAAATAAATTGCA
AGTCCAAGTGTGAATACAGGTGCAGCAAGGCATCGAGGCACAAAATGTGCATAAGGGCTTGCAACACATGCTGTCAGAGGTGCAATTGCGTTCCACCTGG
AACTTCTGGTAACGAAGATACCTGCCCTTGCTATGCCAACATGACCACCCATGGGGGTAGACACAAGTGCCCCTGA
AA sequence
>Potri.013G113400.3 pacid=42810914 polypeptide=Potri.013G113400.3.p locus=Potri.013G113400 ID=Potri.013G113400.3.v4.1 annot-version=v4.1
MVSAKTTFILAILCLALMHELQIRTVEAGKINCKSKCEYRCSKASRHKMCIRACNTCCQRCNCVPPGTSGNEDTCPCYANMTTHGGRHKCP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18420 Gibberellin-regulated family p... Potri.013G113400 0 1
AT4G18550 AtDSEL Arabidopsis thaliana DAD1-like... Potri.004G054600 3.16 0.9997
AT5G62360 Plant invertase/pectin methyle... Potri.015G128400 4.89 0.9997
AT5G51810 AT2353, GA20OX2... gibberellin 20 oxidase 2 (.1) Potri.007G103800 5.29 0.9996 GA20ox5
AT4G00165 Bifunctional inhibitor/lipid-t... Potri.014G059800 5.74 0.9997
AT1G72610 ATGER1, GLP1 A. THALIANA GERMIN-LIKE PROTEI... Potri.003G065266 6.92 0.9993
Potri.011G073116 6.92 0.9997
Potri.014G075251 7.74 0.9997
AT4G33355 Bifunctional inhibitor/lipid-t... Potri.014G046500 8.48 0.9997
AT3G24420 alpha/beta-Hydrolases superfam... Potri.016G062700 9.38 0.9996
AT4G38770 ATPRP4, PRP4 ARABIDOPSIS THALIANA PROLINE-R... Potri.009G129900 11.22 0.9996 PRP4.4

Potri.013G113400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.