Potri.013G113500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09620 244 / 1e-82 Mitochondrial transcription termination factor family protein (.1)
AT4G02990 44 / 3e-05 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
AT2G44020 41 / 0.0003 Mitochondrial transcription termination factor family protein (.1)
AT2G21710 41 / 0.0005 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G038500 42 / 0.0002 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.007G001800 41 / 0.0003 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.013G116700 41 / 0.0003 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 41 / 0.0004 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 41 / 0.0005 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 40 / 0.0006 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.018G051600 40 / 0.001 AT1G74120 501 / 2e-176 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028701 258 / 4e-88 AT4G09620 226 / 1e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10009420 253 / 4e-86 AT4G09620 214 / 6e-71 Mitochondrial transcription termination factor family protein (.1)
Lus10004614 44 / 7e-05 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10022321 43 / 8e-05 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10014877 43 / 0.0001 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10042322 41 / 0.0005 AT2G21710 720 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.013G113500.1 pacid=42812123 polypeptide=Potri.013G113500.1.p locus=Potri.013G113500 ID=Potri.013G113500.1.v4.1 annot-version=v4.1
ATGCTAGGAAGATCACTGGCTTCCCCTCTCTTGACATTTGATTCTGCAGCACGCTCAAGCTGTGTTACTCCTGATCTTGTTACAGCTGCTCCTAATGCTG
CTTGTCTGAACGTGAACTCCTTAGCTCTTCCATCAAATGTAACCCGAGGATACTGTACCTCCCATTTTTCTCCTAGGAAGTGGGCAATTCAATCTACTGC
ACAGGCTGACAACACAACTTTTAGTAATGAAGACAGGAAGACATGGGAAGCATGCAGAGAAGCTCTGTCTGCATTTAATTTCAATGCTGAGGAGAAAGAC
AAGATACTTGGAAAAGCATTTGGTCACGTCCATTCTCCTTACTGGGGTGAACAACGAAAACTAGAAGTCCCCAAATTTGAAATTGTTTGTGAAACGTTGG
ATTATCTGAGGAGCCTTGGTCTTTCAGAAGATGACCTCTTTAAGTTGCTCAAAAAGTTCCCTGAAGTCCTTGGTTGTAGCCTTGAACAAGAATTGAAAAC
TAATGTGAAGATCCTGGAGAAAGATTGGGGAATTAAAGGAAAATCCCTGCAAAAGCTTCTTCTTCGAAACCCAAAAGCTTTGGGATATAATGTTGATTGC
AAGGGAGATTGTATCGCACAATGCACGAGGTGCTGGGCGCGGTTTTAG
AA sequence
>Potri.013G113500.1 pacid=42812123 polypeptide=Potri.013G113500.1.p locus=Potri.013G113500 ID=Potri.013G113500.1.v4.1 annot-version=v4.1
MLGRSLASPLLTFDSAARSSCVTPDLVTAAPNAACLNVNSLALPSNVTRGYCTSHFSPRKWAIQSTAQADNTTFSNEDRKTWEACREALSAFNFNAEEKD
KILGKAFGHVHSPYWGEQRKLEVPKFEIVCETLDYLRSLGLSEDDLFKLLKKFPEVLGCSLEQELKTNVKILEKDWGIKGKSLQKLLLRNPKALGYNVDC
KGDCIAQCTRCWARF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G09620 Mitochondrial transcription te... Potri.013G113500 0 1
AT5G43050 NPQ6 NONPHOTOCHEMICAL QUENCHING 6, ... Potri.012G134700 3.46 0.9509
AT4G29070 Phospholipase A2 family protei... Potri.001G275300 8.36 0.9470
AT3G26900 ATSKL1 Arabidopsis thaliana shikimate... Potri.017G062800 12.16 0.9512 SK1
AT2G39000 Acyl-CoA N-acyltransferases (N... Potri.008G039300 15.87 0.9448
AT4G21445 unknown protein Potri.004G033400 17.66 0.9501
AT5G57040 Lactoylglutathione lyase / gly... Potri.018G056200 19.18 0.9491
AT2G20920 Protein of unknown function (D... Potri.004G177300 21.23 0.9450
AT1G68660 Ribosomal protein L12/ ATP-dep... Potri.008G117800 28.12 0.9224
AT1G59960 NAD(P)-linked oxidoreductase s... Potri.005G097000 28.14 0.9464
AT5G39210 CRR7 chlororespiratory reduction 7 ... Potri.004G120300 29.41 0.9490

Potri.013G113500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.