Potri.013G114500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22700 322 / 5e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT3G11540 58 / 5e-09 SPY SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G56290 43 / 0.0002 EMB2790, PEX5, ATPEX5 EMBRYO DEFECTIVE 2790, ARABIDOPSIS PEROXIN 5, peroxin 5 (.1)
AT3G04240 42 / 0.0008 SEC secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G12400 41 / 0.0009 Hop3 Hop3, stress-inducible protein, putative (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G085200 509 / 0 AT1G22700 324 / 6e-111 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.016G075700 57 / 1e-08 AT3G11540 1505 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.006G208900 56 / 2e-08 AT3G11540 1506 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.018G100700 44 / 8e-05 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.006G178900 44 / 8e-05 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.005G054800 42 / 0.0003 AT3G04710 611 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
Potri.011G170000 42 / 0.0005 AT5G56290 1046 / 0.0 EMBRYO DEFECTIVE 2790, ARABIDOPSIS PEROXIN 5, peroxin 5 (.1)
Potri.001G473100 42 / 0.0008 AT5G56290 978 / 0.0 EMBRYO DEFECTIVE 2790, ARABIDOPSIS PEROXIN 5, peroxin 5 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021972 346 / 1e-120 AT1G22700 312 / 5e-108 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10041265 346 / 2e-118 AT1G22700 303 / 5e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10021336 56 / 2e-08 AT3G11540 1509 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10017009 56 / 3e-08 AT3G11540 1356 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10035117 46 / 2e-05 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10031983 45 / 8e-05 AT4G30480 222 / 9e-76 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10003576 45 / 9e-05 AT3G04240 1606 / 0.0 secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF13414 TPR_11 TPR repeat
Representative CDS sequence
>Potri.013G114500.1 pacid=42812237 polypeptide=Potri.013G114500.1.p locus=Potri.013G114500 ID=Potri.013G114500.1.v4.1 annot-version=v4.1
ATGCTTCTCCAAACCACCATCTCATCATCTCCACCTCTACAACACCTCCACCAGCATCCTCACTCTCTCCTACCATTTGGGTCTCTCAAGTTTAGGCCCC
ACAAGCTCTCTCTTCAGGCCCTTTTTCAGCACTATAGTCCACCAGATTTGACAAATTTTAGGGCAGGCCATGGACTGAATGCCACTCAGTTTACTAATTT
CCAGATACATGGAAAGGAGTCACTAATGGTATCCTCTAGCTCACCGAGTACTGAGAAACCCTCGAGGAATCCTCAGAACATTGAGGACAATGCTTGCATG
AAAAGAGTGATAGTTTCTGTGTCTGCACTCTCATTTGGACAAATCTCATTGTTAACTTCTGTACAAGTGGCACATGCAGGAGAAAGTATCAAACCAGATG
CACTTTATGAGGTTGGGGAGTTATTTGAATTGGGAATCCAGCTCTCTTATCTTCTTTTACTTTTAGCTTTGCTAGGGGTTGGAACTTTCTTTGTGATTCG
TCAAGTTCTAATGCGTAGAGAGCTCGACCTTTCTGCTAAAGAATTGCAGGAGCAAGTAAGAAGCGGTGATGCCTCTGCAACTGGACTTTTTGAACTCGGT
GCAGTAATGCTGAGGAGAAAATTTTACCCGGCTGCTACTAAATATTTACTTCAGGCAATTGAGAAGTGGGATGGTGAGGATCAAGATCTTGCCCAGGTTT
ACAATGCGCTTGGTGTTAGCTATATTCTTGATGGGAAGCTTGACAAGGGAATCAAGCAATTTGAAGCTGCTGTGAAGCTTCAACCAGGGTATGTAACAGC
CTGGAACAATCTTGGTGATGCCTATGAAAAGAAGAAAGACTTGAAGTCAGCTCTCAAGGCATTCGAAGAAGTGCTGCTCTTTGATCCTAACAATAAGGTG
GCAAGGCCAAGAAGAGATGCTTTGAAGGATAAGGTACAAATGTACAAAGGAGTTCCAATCAAGTCTAAGGATAGATGA
AA sequence
>Potri.013G114500.1 pacid=42812237 polypeptide=Potri.013G114500.1.p locus=Potri.013G114500 ID=Potri.013G114500.1.v4.1 annot-version=v4.1
MLLQTTISSSPPLQHLHQHPHSLLPFGSLKFRPHKLSLQALFQHYSPPDLTNFRAGHGLNATQFTNFQIHGKESLMVSSSSPSTEKPSRNPQNIEDNACM
KRVIVSVSALSFGQISLLTSVQVAHAGESIKPDALYEVGELFELGIQLSYLLLLLALLGVGTFFVIRQVLMRRELDLSAKELQEQVRSGDASATGLFELG
AVMLRRKFYPAATKYLLQAIEKWDGEDQDLAQVYNALGVSYILDGKLDKGIKQFEAAVKLQPGYVTAWNNLGDAYEKKKDLKSALKAFEEVLLFDPNNKV
ARPRRDALKDKVQMYKGVPIKSKDR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G22700 Tetratricopeptide repeat (TPR)... Potri.013G114500 0 1
AT1G17650 GR2, GLYR2 glyoxylate reductase 2 (.1) Potri.003G040800 3.60 0.9684
AT5G55220 trigger factor type chaperone ... Potri.015G065900 4.24 0.9659
AT4G28080 Tetratricopeptide repeat (TPR)... Potri.006G180100 5.91 0.9577
AT1G72640 NAD(P)-binding Rossmann-fold s... Potri.003G063800 6.70 0.9627
AT5G35170 adenylate kinase family protei... Potri.018G113400 6.92 0.9645
AT1G04420 NAD(P)-linked oxidoreductase s... Potri.008G167400 7.14 0.9653
AT1G02475 Polyketide cyclase/dehydrase a... Potri.002G190300 7.28 0.9382
AT4G28706 pfkB-like carbohydrate kinase ... Potri.002G254500 10.48 0.9497
AT1G52510 alpha/beta-Hydrolases superfam... Potri.001G201500 10.48 0.9557
AT4G12800 PSAL photosystem I subunit l (.1) Potri.002G239700 10.67 0.9627 Pt-PSAL.3

Potri.013G114500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.