Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27410 95 / 5e-23 DNA repair metallo-beta-lactamase family protein (.1) AT1G62930 87 / 5e-20 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62670 86 / 1e-19 RPF2 rna processing factor 2 (.1) AT1G63080 85 / 3e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62590 85 / 3e-19 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G63130 85 / 4e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63400 84 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 83 / 2e-18 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G62680 82 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63330 82 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G025600 [exp] 130 / 7e-35 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G038300 [exp] 125 / 2e-33 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G149800 [exp] 125 / 3e-33 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G150100 [exp] 113 / 4e-29 AT1G62930 442 / 8e-149 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G257300 [exp] 110 / 4e-28 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074700 [exp] 110 / 4e-28 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074500 [exp] 107 / 3e-27 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242200 [exp] 105 / 4e-26 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G117600 [exp] 103 / 7e-26 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014242 [exp] 81 / 1e-17 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 81 / 1e-17 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003433 [exp] 80 / 3e-17 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014247 [exp] 79 / 6e-17 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022861 [exp] 78 / 8e-17 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10009201 [exp] 77 / 8e-17 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 75 / 9e-16 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019524 [exp] 74 / 4e-15 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039310 [exp] 72 / 4e-15 AT3G22470 226 / 6e-70 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021074 [exp] 72 / 8e-15 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.013G121101.1 pacid=42811761 polypeptide=Potri.013G121101.1.p locus=Potri.013G121101 ID=Potri.013G121101.1.v4.1 annot-version=v4.1 ATGCCATCTGGTCTTCCATGGGTGCTGAAACCTGTTAAAGGAGATGACAATCTTTTCGGTTCTCTCTTAACTTCTCGTTACAAAAAAAGACAGCCGTCTG ATAAGCTGGACGAGATACAAGAGTTTATTGAACTTGTCCAACCAGCTAACATGAAAGGTATTGTGTCTTCATCATCTTGTTATGTTGACCCACTTTATTA CTTCAGTCGCCTTTATGGTGTAAACCAACCACCAAAGAGAGGAAAGAAGAAAAAGAAGGCGAGATATCAGATCATAAGTGGCTTGTTTTTCAATGTTAGT TATACCACTTTTATAAGTGGCTTGTTTCAGGCAGGGAGAGTTTTGGAAGCAAAAGAGCTTTTCAAGGATATACGTGCCCAAAGCCATTTCCCAGATTTAA TGACCTACTCAACTTTGCTTGATGGCTTAAGAAAACAAGGGTATCTTGATCAAGCGTTGGGACTATTTCATGACATGCAAAAAAGTTACTTGAAGTCTCA TGATTTGGTGATCTATGATATCATAATCATTGCCATGTGCAGATCTAGGAAGCTTAAAGATGCATTGGAGTTGTTTTCGGAACTCATTCAAAGGGTTGCA GCCTGA
AA sequence Show only first row Show all	>Potri.013G121101.1 pacid=42811761 polypeptide=Potri.013G121101.1.p locus=Potri.013G121101 ID=Potri.013G121101.1.v4.1 annot-version=v4.1 MPSGLPWVLKPVKGDDNLFGSLLTSRYKKRQPSDKLDEIQEFIELVQPANMKGIVSSSSCYVDPLYYFSRLYGVNQPPKRGKKKKKARYQIISGLFFNVS YTTFISGLFQAGRVLEAKELFKDIRAQSHFPDLMTYSTLLDGLRKQGYLDQALGLFHDMQKSYLKSHDLVIYDIIIIAMCRSRKLKDALELFSELIQRVA A

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G27410			DNA repair metallo-beta-lactam...		Potri.013G121101 [exp]	0	1
AT2G01690			ARM repeat superfamily protein...		Potri.010G106700 [exp]	3.74	0.7199
AT3G15351			unknown protein		Potri.014G057550 [exp]	4.00	0.7209
AT5G41700		ATUBC8, UBC8	ARABIDOPSIS THALIANA UBIQUITIN...		Potri.013G158600 [exp]	7.48	0.6890
AT1G27410			DNA repair metallo-beta-lactam...		Potri.013G121700 [exp]	8.48	0.7100
AT5G14345		AtENODL21	early nodulin-like protein 21 ...		Potri.015G113300 [exp]	17.14	0.6475
AT5G09310			unknown protein		Potri.007G106200 [exp]	23.23	0.6678
					Potri.004G047932 [exp]	24.18	0.6587
AT2G43980		ATITPK4	"inositol 1,3,4-trisphosphate ...		Potri.007G144701 [exp]	24.53	0.6589
AT2G21385			unknown protein		Potri.009G121902 [exp]	30.16	0.6640
AT4G36050			endonuclease/exonuclease/phosp...		Potri.005G113301 [exp]	31.60	0.6371

Compare expression of checked genes

Potri.013G121101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.