Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19130 70 / 2e-15 S-locus lectin protein kinase family protein (.1) AT4G11900 63 / 4e-13 S-locus lectin protein kinase family protein (.1) AT4G21380 59 / 2e-11 ARK3 receptor kinase 3 (.1) AT4G27290 56 / 1e-10 S-locus lectin protein kinase family protein (.1) AT1G61390 55 / 4e-10 S-locus lectin protein kinase family protein (.1.2) AT1G11340 54 / 1e-09 S-locus lectin protein kinase family protein (.1) AT1G11280 53 / 1e-09 S-locus lectin protein kinase family protein (.1.2.3.4) AT4G21390 52 / 4e-09 B120 S-locus lectin protein kinase family protein (.1) AT1G11300 52 / 4e-09 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G61380 51 / 7e-09 SD1-29 S-domain-1 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G121350 [exp] 153 / 2e-50 AT2G19130 63 / 5e-13 S-locus lectin protein kinase family protein (.1) Potri.013G121000 [exp] 164 / 9e-49 AT2G19130 863 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G149500 [exp] 160 / 3e-47 AT2G19130 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119200 [exp] 141 / 1e-40 AT2G19130 874 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G412000 [exp] 69 / 4e-15 AT4G27290 815 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125651 [exp] 67 / 1e-14 AT4G27290 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G134900 [exp] 63 / 6e-13 AT4G21390 662 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G129000 [exp] 62 / 1e-12 AT4G27290 818 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G128650 [exp] 61 / 2e-12 AT4G27290 225 / 8e-69 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028782 [exp] 82 / 1e-19 AT4G21380 649 / 0.0 receptor kinase 3 (.1) Lus10039733 [exp] 81 / 3e-19 AT4G27290 615 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10012955 [exp] 74 / 1e-17 AT2G19130 155 / 2e-43 S-locus lectin protein kinase family protein (.1) Lus10029802 [exp] 75 / 3e-17 AT2G19130 729 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018516 [exp] 70 / 2e-15 AT1G11300 699 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10039767 [exp] 69 / 5e-15 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039731 [exp] 69 / 6e-15 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10031596 [exp] 68 / 8e-15 AT2G19130 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033741 [exp] 67 / 4e-14 AT4G21380 576 / 0.0 receptor kinase 3 (.1) Lus10039762 [exp] 66 / 4e-14 AT2G19130 621 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G121550.1 pacid=42811457 polypeptide=Potri.013G121550.1.p locus=Potri.013G121550 ID=Potri.013G121550.1.v4.1 annot-version=v4.1 ATGGATGTCCGAAACAATCCATGGATCATGTTTTTGGTTATCTTTTTTTGTTTTCCTCTCAACTCCCATGTCTCCCTTGGAGCTGATACAATCTCTGCAA ACAGTTCTCTCTCTGGAGACCAAACTATTGTCTCAGCACGAAAAGTCTTTGAACTTGGTTTCTTCCATCCAGGTAACTCCTTATCTCAAACTACTAATAT AGGCATGTGGTACTGTAGAGATAAAGTGTCTGAACAGACCATAGTTTGGGTAGCAAACAGAGACACCCGTTTCTGA
AA sequence Show only first row Show all	>Potri.013G121550.1 pacid=42811457 polypeptide=Potri.013G121550.1.p locus=Potri.013G121550 ID=Potri.013G121550.1.v4.1 annot-version=v4.1 MDVRNNPWIMFLVIFFCFPLNSHVSLGADTISANSSLSGDQTIVSARKVFELGFFHPGNSLSQTTNIGMWYCRDKVSEQTIVWVANRDTRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G19130			S-locus lectin protein kinase ...		Potri.013G121550 [exp]	0	1
AT2G14820		MEL3, NPY2	NAKED PINS IN YUC MUTANTS 2, M...		Potri.005G146400 [exp]	12.24	0.7835
AT1G18390			Protein kinase superfamily pro...		Potri.010G120800 [exp]	14.28	0.8047
AT2G19130			S-locus lectin protein kinase ...		Potri.013G121000 [exp]	14.59	0.7935
AT4G00150	GRAS	ATHAM3, SCL6, L...	LOST MERISTEMS 3, ARABIDOPSIS ...		Potri.014G060500 [exp]	21.21	0.7840
AT2G01060	GARP		myb-like HTH transcriptional r...		Potri.016G001100 [exp]	21.49	0.7526
AT4G39400		DWF2, CBB2, BIN...	DWARF 2, CABBAGE 2, BRASSINOST...		Potri.007G078100 [exp]	21.63	0.7855	Pt-BRI1.2
AT2G31955		CNX2	cofactor of nitrate reductase ...		Potri.009G024100 [exp]	39.50	0.7832	CNX2.1
AT2G29970			Double Clp-N motif-containing ...		Potri.001G252500 [exp]	40.69	0.7306
AT3G26890			unknown protein		Potri.015G103500 [exp]	45.25	0.6953
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G072966 [exp]	52.24	0.7297

Compare expression of checked genes

Potri.013G121550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.