Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06260 62 / 2e-12 Cysteine proteinases superfamily protein (.1) AT5G45890 60 / 1e-11 SAG12 senescence-associated gene 12 (.1) AT3G48340 58 / 6e-11 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1) AT1G20850 48 / 2e-07 XCP2 xylem cysteine peptidase 2 (.1) AT5G50260 44 / 4e-06 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT3G48350 39 / 0.0003 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1) AT1G09850 38 / 0.0006 XBCP3 xylem bark cysteine peptidase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G183100 [exp] 51 / 2e-08 AT5G50260 489 / 2e-174 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Potri.004G055900 [exp] 47 / 6e-07 AT5G45890 438 / 5e-155 senescence-associated gene 12 (.1) Potri.004G207600 [exp] 46 / 8e-07 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2) Potri.007G076000 [exp] 45 / 2e-06 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1) Potri.007G076100 [exp] 45 / 2e-06 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1) Potri.007G075900 [exp] 45 / 2e-06 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1) Potri.013G118400 [exp] 44 / 3e-06 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1) Potri.007G075300 [exp] 44 / 7e-06 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1) Potri.005G089100 [exp] 42 / 2e-05 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039901 [exp] 77 / 2e-17 AT1G06260 346 / 4e-117 Cysteine proteinases superfamily protein (.1) Lus10017674 [exp] 67 / 4e-14 AT1G06260 310 / 2e-104 Cysteine proteinases superfamily protein (.1) Lus10026073 [exp] 59 / 3e-11 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1) Lus10020723 [exp] 58 / 7e-11 AT5G45890 398 / 3e-139 senescence-associated gene 12 (.1) Lus10013674 [exp] 55 / 9e-10 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10002301 [exp] 53 / 5e-09 AT5G45890 397 / 1e-138 senescence-associated gene 12 (.1) Lus10002184 [exp] 52 / 6e-09 AT1G06260 384 / 1e-133 Cysteine proteinases superfamily protein (.1) Lus10026362 [exp] 52 / 9e-09 AT5G45890 396 / 2e-138 senescence-associated gene 12 (.1) Lus10042295 [exp] 52 / 1e-08 AT5G45890 402 / 7e-141 senescence-associated gene 12 (.1) Lus10032406 [exp] 50 / 4e-08 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G124250.1 pacid=42812174 polypeptide=Potri.013G124250.1.p locus=Potri.013G124250 ID=Potri.013G124250.1.v4.1 annot-version=v4.1 ATGGTTGAGTTGATCCGCACAGGAGCCACTGAATATACCACTGGAATAGAGTTGAAATTCAAAATTACCAGCGTCAATTGCAACAGAGACAGGTTGCTGG GCAACTGCAGCTTGTACTCTATTCTAATTATTGGCAGGTACTGCTTCATAACCACTTATTTTCACTGCATGGTCCCTAGTTTTCTTTTTCTGACAGGTGC CGTCTTTTCCTTTGTAAGGGTAGTCATTTTCGGTTGTGATTCCACCAATCTTTTTGATGTATTGAAATGTTATCTTCATGTCTCCGCCTTCACAGCCCTG GGTATCACTGCTAACGTCACATTCCATGAGCTCTTGTTCTGA
AA sequence Show only first row Show all	>Potri.013G124250.1 pacid=42812174 polypeptide=Potri.013G124250.1.p locus=Potri.013G124250 ID=Potri.013G124250.1.v4.1 annot-version=v4.1 MVELIRTGATEYTTGIELKFKITSVNCNRDRLLGNCSLYSILIIGRYCFITTYFHCMVPSFLFLTGAVFSFVRVVIFGCDSTNLFDVLKCYLHVSAFTAL GITANVTFHELLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.013G124250 [exp]	0	1
AT5G47490			RGPR-related (.1)		Potri.003G077100 [exp]	63.74	0.6192
AT5G34883			Protein of unknown function (D...		Potri.018G045400 [exp]	110.01	0.5370

Compare expression of checked genes

Potri.013G124250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.