Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12203 120 / 2e-34 SCPL17 serine carboxypeptidase-like 17 (.1) AT3G10450 119 / 5e-34 SCPL7 serine carboxypeptidase-like 7 (.1.2) AT1G73300 115 / 2e-32 SCPL2 serine carboxypeptidase-like 2 (.1) AT2G22960 109 / 4e-32 alpha/beta-Hydrolases superfamily protein (.1) AT5G36180 114 / 8e-32 SCPL1 serine carboxypeptidase-like 1 (.1) AT2G22980 114 / 9e-32 SCPL13 serine carboxypeptidase-like 13 (.1.2.3.4) AT1G73280 114 / 1e-31 SCPL3 serine carboxypeptidase-like 3 (.1) AT2G23010 113 / 2e-31 SCPL9 serine carboxypeptidase-like 9 (.1.2) AT1G73310 112 / 4e-31 SCPL4 serine carboxypeptidase-like 4 (.1) AT2G22990 110 / 5e-31 SCPL8, SNG1 SERINE CARBOXYPEPTIDASE-LIKE 8, sinapoylglucose 1 (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G124900 [exp] 155 / 2e-47 AT1G73280 513 / 0.0 serine carboxypeptidase-like 3 (.1) Potri.001G291450 [exp] 97 / 1e-26 AT2G22960 149 / 3e-45 alpha/beta-Hydrolases superfamily protein (.1) Potri.001G291300 [exp] 99 / 4e-26 AT1G33540 434 / 9e-150 serine carboxypeptidase-like 18 (.1) Potri.001G291800 [exp] 99 / 6e-26 AT1G73300 432 / 1e-148 serine carboxypeptidase-like 2 (.1) Potri.001G290900 [exp] 98 / 1e-25 AT1G33540 430 / 8e-148 serine carboxypeptidase-like 18 (.1) Potri.019G054300 [exp] 91 / 3e-23 AT4G12910 636 / 0.0 serine carboxypeptidase-like 20 (.1) Potri.014G177500 [exp] 91 / 3e-23 AT4G12910 743 / 0.0 serine carboxypeptidase-like 20 (.1) Potri.001G312800 [exp] 88 / 5e-22 AT1G33540 402 / 3e-137 serine carboxypeptidase-like 18 (.1) Potri.009G055900 [exp] 77 / 4e-18 AT3G63470 570 / 0.0 serine carboxypeptidase-like 40 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018667 [exp] 130 / 1e-36 AT1G73280 478 / 2e-153 serine carboxypeptidase-like 3 (.1) Lus10007731 [exp] 124 / 3e-35 AT5G09640 504 / 4e-177 SINAPOYLGLUCOSE ACCUMULATOR 2, serine carboxypeptidase-like 19 (.1) Lus10007732 [exp] 122 / 1e-34 AT3G12203 423 / 7e-146 serine carboxypeptidase-like 17 (.1) Lus10010895 [exp] 119 / 2e-33 AT1G73280 444 / 6e-154 serine carboxypeptidase-like 3 (.1) Lus10009562 [exp] 95 / 2e-24 AT4G12910 617 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10025859 [exp] 92 / 2e-23 AT4G12910 694 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10038240 [exp] 89 / 2e-22 AT4G12910 689 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10020387 [exp] 89 / 3e-22 AT4G12910 627 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10020206 [exp] 83 / 3e-20 AT4G12910 603 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10020207 [exp] 82 / 9e-20 AT4G12910 553 / 0.0 serine carboxypeptidase-like 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF00450 [poplar] [flax] Peptidase_S10 Serine carboxypeptidase
Representative CDS sequence Show only first row Show all	>Potri.013G124750.1 pacid=42811369 polypeptide=Potri.013G124750.1.p locus=Potri.013G124750 ID=Potri.013G124750.1.v4.1 annot-version=v4.1 ATGGAGGTACCATTCTTGGGAACTCAAGCATGGATAAGATCTTTAAACTACTCTATTGTTGATGACTGGCATCCATGGCACTTTCAAGGTCAAGTTGCAG GATACACGAGGACTTACTCTAGTCAATTGACATTTGCGACTGTAAAGGGTGGAGGGCACACTGCTCCTGGATACAGGCCTGCAGAATGTTTTGCCATGTT TAAAAGGTGGATAGTTCAAGAACCTTTGTAA
AA sequence Show only first row Show all	>Potri.013G124750.1 pacid=42811369 polypeptide=Potri.013G124750.1.p locus=Potri.013G124750 ID=Potri.013G124750.1.v4.1 annot-version=v4.1 MEVPFLGTQAWIRSLNYSIVDDWHPWHFQGQVAGYTRTYSSQLTFATVKGGGHTAPGYRPAECFAMFKRWIVQEPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G12203		SCPL17	serine carboxypeptidase-like 1...		Potri.013G124750 [exp]	0	1
AT3G49490			unknown protein		Potri.002G230100 [exp]	3.16	0.7850
AT4G02550			unknown protein		Potri.019G009855 [exp]	12.32	0.7668
AT2G07340		PFD1	PREFOLDIN 1 (.1.2)		Potri.018G149200 [exp]	15.29	0.7499
AT3G26740		CCL	CCR-like (.1)		Potri.003G163402 [exp]	36.46	0.6853
AT5G10940		ASG2	ALTERED SEED GERMINATION 2, tr...		Potri.002G103066 [exp]	44.59	0.7281
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Potri.005G054900 [exp]	45.36	0.7677
AT5G01510		RUS5	ROOT UV-B SENSITIVE 5, Protein...		Potri.006G099700 [exp]	47.37	0.7585
AT5G26250			Major facilitator superfamily ...		Potri.008G150800 [exp]	65.03	0.7549
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Potri.017G148266 [exp]	74.45	0.7269
					Potri.010G134800 [exp]	91.65	0.7181

Compare expression of checked genes

Potri.013G124750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.