Pt-ATEP3.1 (Potri.013G125000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-ATEP3.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G54420 421 / 1e-150 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
AT2G43590 311 / 5e-107 Chitinase family protein (.1)
AT2G43580 296 / 4e-101 Chitinase family protein (.1)
AT2G43570 267 / 1e-89 CHI "chitinase, putative", chitinase, putative (.1)
AT2G43610 249 / 1e-82 Chitinase family protein (.1)
AT2G43620 243 / 4e-80 Chitinase family protein (.1)
AT3G47540 209 / 2e-67 Chitinase family protein (.1.2)
AT1G56680 188 / 1e-58 Chitinase family protein (.1)
AT1G02360 176 / 7e-54 Chitinase family protein (.1)
AT2G43600 171 / 5e-52 Chitinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G093700 485 / 9e-176 AT3G54420 413 / 3e-147 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G093800 404 / 1e-143 AT3G54420 369 / 8e-130 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.013G125100 376 / 9e-133 AT3G54420 336 / 1e-116 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G093900 372 / 4e-131 AT3G54420 360 / 3e-126 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G094000 363 / 2e-127 AT3G54420 340 / 2e-118 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G094100 362 / 3e-127 AT3G54420 350 / 3e-122 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.009G141700 194 / 2e-60 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.004G182000 189 / 2e-58 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.002G186500 182 / 2e-56 AT1G02360 413 / 2e-147 Chitinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000453 392 / 6e-139 AT3G54420 382 / 3e-135 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10035625 261 / 6e-87 AT3G54420 266 / 7e-89 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10003587 249 / 5e-83 AT2G43590 270 / 1e-91 Chitinase family protein (.1)
Lus10003226 251 / 2e-82 AT3G54420 269 / 2e-89 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10032794 247 / 3e-82 AT2G43590 265 / 6e-90 Chitinase family protein (.1)
Lus10010861 243 / 1e-80 AT2G43590 263 / 6e-89 Chitinase family protein (.1)
Lus10003231 242 / 2e-80 AT3G54420 241 / 2e-80 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10010862 242 / 2e-80 AT2G43590 262 / 1e-88 Chitinase family protein (.1)
Lus10035621 248 / 5e-80 AT3G54420 243 / 2e-78 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10024368 240 / 1e-79 AT2G43590 264 / 2e-89 Chitinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0037 Lysozyme PF00182 Glyco_hydro_19 Chitinase class I
CL0037 PF00187 Chitin_bind_1 Chitin recognition protein
Representative CDS sequence
>Potri.013G125000.1 pacid=42810833 polypeptide=Potri.013G125000.1.p locus=Potri.013G125000 ID=Potri.013G125000.1.v4.1 annot-version=v4.1
ATGGCATCCTCTACAAGGAAAAGCCAGTTAGTCATTGTCTTGCTAGGAATTCTAATTGCAGGATCAGCTGTGCCGAGCCATGTTGTAGCTCAAAATTGTG
GCTGTGCTGCAGACGAATGTTGCAGCCGATGGGGTTACTGTGGCACCGGCAATGACTATTGCGGCACCGGGTGTCAAGAGGGTCAGTGTTTCCCGGCAGC
TCCCACCAACGATGTTTCAGTGCCTGATATCGTGACCCCAGAGTTTTTCGGTGGGATCCTTGATCAAGCTGATTCAAGCTGTGCTGGGAAGAACTTCTAT
TCACGAGACGCGTTCCTTGAGGCTCTCAATTCATACTCTCGGTTTGGTAGGATTGGTTCGGTTGACGATTCCAGGCGTGAGATCGCAGCTTTCTTCGCCC
ATGTCACCCATGAAACTGGACATTTTTGCTACATAGAAGAGATCAATGGACCATCAAGGGACTACTGCGACGAGGGCAATACGCAATATCCATGCAATCC
TGATAAAGGTTACTACGGCCGAGGACCAATCCAACTATCATGGAATTTCAATTATGGACCTGCCGGAGAAAGCATCGGTTTTGATGGATTAAACTCTCCT
GAAACTGTGGCCAATGACCCTGTAATTTCATTCAAGACAGCTCTGTGGTATTGGACTAACTCTGTCCAACCTGTAATTAGCCAAGGGTTTGGGGCGACGA
TTAGAGCCATTAATGGCGCCCTTGAATGTGACGGAGCAAATCCTGCTACTGTTCAAGCTCGTGTAGGGTATTATACCGATTACTGTAATCAACTGGGTGT
GGCTCCTGGAGATAACCTTACTTGTTAG
AA sequence
>Potri.013G125000.1 pacid=42810833 polypeptide=Potri.013G125000.1.p locus=Potri.013G125000 ID=Potri.013G125000.1.v4.1 annot-version=v4.1
MASSTRKSQLVIVLLGILIAGSAVPSHVVAQNCGCAADECCSRWGYCGTGNDYCGTGCQEGQCFPAAPTNDVSVPDIVTPEFFGGILDQADSSCAGKNFY
SRDAFLEALNSYSRFGRIGSVDDSRREIAAFFAHVTHETGHFCYIEEINGPSRDYCDEGNTQYPCNPDKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSP
ETVANDPVISFKTALWYWTNSVQPVISQGFGATIRAINGALECDGANPATVQARVGYYTDYCNQLGVAPGDNLTC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Potri.013G125000 0 1 Pt-ATEP3.1
AT5G25930 Protein kinase family protein ... Potri.006G235800 2.82 0.8941
AT5G25930 Protein kinase family protein ... Potri.006G235500 4.69 0.8915
AT2G22860 ATPSK2 phytosulfokine 2 precursor (.1... Potri.002G116300 6.24 0.8646
AT1G35710 Protein kinase family protein ... Potri.002G258400 6.92 0.8487
AT3G05650 AtRLP32 receptor like protein 32 (.1) Potri.012G008911 7.74 0.8539
AT3G51480 ATGLR3.6 glutamate receptor 3.6 (.1) Potri.005G102600 12.36 0.7846
AT4G04720 CPK21 calcium-dependent protein kina... Potri.011G003400 12.40 0.8486
AT2G27430 ARM repeat superfamily protein... Potri.004G055500 12.84 0.8370
AT1G07900 AS2 LBD1 LOB domain-containing protein ... Potri.014G167100 14.38 0.8392
AT2G41180 SIB2 sigma factor binding protein 2... Potri.019G013300 15.74 0.8608

Potri.013G125000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.