Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59650 202 / 6e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2) AT5G47890 40 / 4e-05 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G071900 [exp] 38 / 0.0003 AT5G47890 145 / 8e-47 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010559 [exp] 197 / 8e-67 AT3G59650 201 / 2e-68 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2) Lus10006114 [exp] 194 / 1e-65 AT3G59650 204 / 2e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2) Lus10022178 [exp] 136 / 3e-39 AT3G59650 138 / 2e-39 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2) Lus10003023 [exp] 40 / 4e-05 AT5G47890 155 / 4e-51 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Lus10011053 [exp] 40 / 4e-05 AT5G47890 155 / 4e-51 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1) Lus10040122 [exp] 40 / 7e-05 AT5G47890 150 / 8e-49 NADH-ubiquinone oxidoreductase B8 subunit, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF05047 [poplar] [flax] L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Representative CDS sequence Show only first row Show all	>Potri.013G126200.1 pacid=42812371 polypeptide=Potri.013G126200.1.p locus=Potri.013G126200 ID=Potri.013G126200.1.v4.1 annot-version=v4.1 ATGGCTTGGAAAGGTATATGGCAGCTGAAAAAGCTGGTTGTGAGCTACTGTGACTGGGGAGGAAGTAGTAGGGGTATCAGGGCCTTCATAGAGTCAAACC TGCCAGCATATAAGGATAGCAATCCACAACTAGAGGTGATCACTGAACTTTCTCGCGGTCAGCATCCATGTTTGAAGGCTTTTTACAAGAACAAAAATGA GAGGGTGGTATGTGTGAAGAATTTGGCATCAGAAGACGTACTTCTTCATGCTACCAGGCTAAGGAATGCGTTGGGAAGAAAAGTGAAAAAACTGCCAACA AGGCATGTGACCAAACACCCTAGCGTACAGGGTACATGGACGACTGATGTTAGATTTTGA
AA sequence Show only first row Show all	>Potri.013G126200.1 pacid=42812371 polypeptide=Potri.013G126200.1.p locus=Potri.013G126200 ID=Potri.013G126200.1.v4.1 annot-version=v4.1 MAWKGIWQLKKLVVSYCDWGGSSRGIRAFIESNLPAYKDSNPQLEVITELSRGQHPCLKAFYKNKNERVVCVKNLASEDVLLHATRLRNALGRKVKKLPT RHVTKHPSVQGTWTTDVRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G59650			mitochondrial ribosomal protei...		Potri.013G126200 [exp]	0	1
AT2G18400			ribosomal protein L6 family pr...		Potri.007G024900 [exp]	1.00	0.9027
AT4G39880			Ribosomal protein L23/L15e fam...		Potri.005G075500 [exp]	1.41	0.8883
AT3G13674			unknown protein		Potri.018G082800 [exp]	3.16	0.8691
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.011G149800 [exp]	3.46	0.8851	TIM13.2
AT3G08980			Peptidase S24/S26A/S26B/S26C f...		Potri.016G115100 [exp]	4.89	0.8690
AT5G52370			unknown protein		Potri.009G040100 [exp]	5.29	0.8643
AT3G13230			RNA-binding KH domain-containi...		Potri.011G166000 [exp]	5.74	0.8275
AT1G07070			Ribosomal protein L35Ae family...		Potri.010G194200 [exp]	6.00	0.8856
AT2G27960		CKS1AT, CKS1	cyclin-dependent kinase-subuni...		Potri.009G004000 [exp]	6.24	0.7801
AT4G01310			Ribosomal L5P family protein (...		Potri.014G089100 [exp]	6.92	0.8265	RPL5.2

Compare expression of checked genes

Potri.013G126200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.