Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43770 196 / 2e-63 Transducin/WD40 repeat-like superfamily protein (.1) AT3G15880 54 / 1e-09 WSIP2, TPR4 TOPLESS-RELATED 4, WUS-interacting protein 2 (.1.2.3) AT1G61210 50 / 3e-08 DWA3 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2) AT3G16650 50 / 3e-08 Transducin/WD40 repeat-like superfamily protein (.1) AT5G25150 50 / 4e-08 TAF5 TBP-associated factor 5 (.1) AT1G11160 50 / 5e-08 Transducin/WD40 repeat-like superfamily protein (.1) AT5G08390 49 / 8e-08 Transducin/WD40 repeat-like superfamily protein (.1) AT4G15900 49 / 8e-08 PRL1 pleiotropic regulatory locus 1 (.1) AT5G23430 48 / 3e-07 Transducin/WD40 repeat-like superfamily protein (.1.2) AT1G80490 46 / 1e-06 TPR1 TOPLESS-related 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G096900 [exp] 203 / 2e-66 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.006G263400 [exp] 52 / 9e-09 AT5G25150 1018 / 0.0 TBP-associated factor 5 (.1) Potri.019G087200 [exp] 51 / 2e-08 AT1G71840 515 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Potri.018G020200 [exp] 51 / 2e-08 AT5G25150 984 / 0.0 TBP-associated factor 5 (.1) Potri.018G128000 [exp] 50 / 3e-08 AT3G15880 1650 / 0.0 TOPLESS-RELATED 4, WUS-interacting protein 2 (.1.2.3) Potri.006G066800 [exp] 50 / 3e-08 AT3G15880 1689 / 0.0 TOPLESS-RELATED 4, WUS-interacting protein 2 (.1.2.3) Potri.010G012800 [exp] 50 / 4e-08 AT4G15900 731 / 0.0 pleiotropic regulatory locus 1 (.1) Potri.013G081300 [exp] 50 / 6e-08 AT1G15750 1540 / 0.0 WUS-INTERACTING PROTEIN 1, TOPLESS, Transducin family protein / WD-40 repeat family protein (.1.2.3.4) Potri.011G045500 [exp] 50 / 6e-08 AT1G61210 723 / 0.0 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012230 [exp] 194 / 1e-62 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10002860 [exp] 185 / 4e-59 AT2G43770 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10003390 [exp] 107 / 4e-31 AT2G43770 236 / 6e-79 Transducin/WD40 repeat-like superfamily protein (.1) Lus10007449 [exp] 53 / 5e-09 AT5G25150 957 / 0.0 TBP-associated factor 5 (.1) Lus10024447 [exp] 51 / 2e-08 AT5G25150 1006 / 0.0 TBP-associated factor 5 (.1) Lus10043258 [exp] 50 / 3e-08 AT3G15880 1776 / 0.0 TOPLESS-RELATED 4, WUS-interacting protein 2 (.1.2.3) Lus10019401 [exp] 50 / 5e-08 AT1G15750 1596 / 0.0 WUS-INTERACTING PROTEIN 1, TOPLESS, Transducin family protein / WD-40 repeat family protein (.1.2.3.4) Lus10011224 [exp] 50 / 7e-08 AT1G11160 665 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10018458 [exp] 50 / 7e-08 AT1G11160 668 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10038094 [exp] 49 / 9e-08 AT1G80490 1525 / 0.0 TOPLESS-related 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00400 [poplar] [flax] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Potri.013G128001.1 pacid=42812256 polypeptide=Potri.013G128001.1.p locus=Potri.013G128001 ID=Potri.013G128001.1.v4.1 annot-version=v4.1 ATGGAACTGCAAAACTTTGGGCGCCCAAAGGGTGCCATCCAAACATTTCCAGATAAATACCAAATCACAGCTGCCAGTTTCCCTGATATATCAGATAAGA TATTCACAGGTGTTATAGACAATGATATTAAGGTAAGGGACATCCGCAAGGGTGAAGTGACCATGACACTTGAGGGCCATCAGGATATGATTACAGGTAT GCAGTTGAGTCCTGATGGCTCATATCTGCTTATGAATGGCATGGACAACAAGCTCTGCATTTGGGATATGCGCCCCTTTGCACCACAAAATCGTTGTGTG AAGATTTTTGAAGGGCACCAGCACAACAACTTTGAAAAGAACTTGTGA
AA sequence Show only first row Show all	>Potri.013G128001.1 pacid=42812256 polypeptide=Potri.013G128001.1.p locus=Potri.013G128001 ID=Potri.013G128001.1.v4.1 annot-version=v4.1 MELQNFGRPKGAIQTFPDKYQITAASFPDISDKIFTGVIDNDIKVRDIRKGEVTMTLEGHQDMITGMQLSPDGSYLLMNGMDNKLCIWDMRPFAPQNRCV KIFEGHQHNNFEKNL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G43770			Transducin/WD40 repeat-like su...		Potri.013G128001 [exp]	0	1
AT4G38180	FAR1_related	FRS5	FAR1-related sequence 5 (.1)		Potri.015G139300 [exp]	5.83	0.7008
AT1G27620			HXXXD-type acyl-transferase fa...		Potri.002G032200 [exp]	7.41	0.6482
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.013G034200 [exp]	11.53	0.6327
AT5G28150			Plant protein of unknown funct...		Potri.013G038000 [exp]	18.73	0.6924
AT3G52570			alpha/beta-Hydrolases superfam...		Potri.016G076601 [exp]	22.51	0.6162
AT1G05180		AXR1	AUXIN RESISTANT 1, NAD(P)-bind...		Potri.002G229100 [exp]	23.49	0.6168
AT1G43190		PTB3	polypyrimidine tract-binding p...		Potri.002G066000 [exp]	24.55	0.5563
AT5G40740			unknown protein		Potri.001G337700 [exp]	25.98	0.5907
AT3G49990			unknown protein		Potri.002G028100 [exp]	27.45	0.5960
AT5G27540		MIRO1, EMB2473	embryo defective 2473, MIRO-re...		Potri.005G033700 [exp]	28.98	0.5881

Compare expression of checked genes

Potri.013G128001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.