Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34620 138 / 9e-44 SSR16 small subunit ribosomal protein 16 (.1) AT5G56940 134 / 7e-42 Ribosomal protein S16 family protein (.1) ATCG00050 61 / 1e-13 ATCG00050.1, RPS16 ribosomal protein S16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G217400 [exp] 138 / 2e-43 AT5G56940 188 / 7e-63 Ribosomal protein S16 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025592 [exp] 148 / 1e-47 AT4G34620 137 / 2e-43 small subunit ribosomal protein 16 (.1) Lus10027058 [exp] 147 / 4e-47 AT4G34620 136 / 4e-43 small subunit ribosomal protein 16 (.1) Lus10025984 [exp] 138 / 3e-43 AT5G56940 208 / 1e-70 Ribosomal protein S16 family protein (.1) Lus10014281 [exp] 137 / 5e-43 AT5G56940 210 / 2e-71 Ribosomal protein S16 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00886 [poplar] [flax] Ribosomal_S16 Ribosomal protein S16
Representative CDS sequence Show only first row Show all	>Potri.013G128200.1 pacid=42811842 polypeptide=Potri.013G128200.1.p locus=Potri.013G128200 ID=Potri.013G128200.1.v4.1 annot-version=v4.1 ATGGCAGTGAAGATTCGTTTAGCTAGACTGGGATGCAAAAACAGGGCATTTTACAGAATCGTTGCTGCTGATAGCCATACACCAAGAGATGGCAAGCACC TTCAAGTTCTTGGTTTCTATGACCCCTTAGCAGCTAAAGGCGATGCTAGAAGATTGGGTCTTAATGTTGACCTTGTGAAGTATTGGTTATCGGTCGGTGC TCAACCTACAGACACTGTACGTGGCATTCTTATGAGAGCTGGTTTAATATCCCCACCACCAATGGTTGTGATGGGACAGAAAAAGGGACCATCTGGTGAT ACCTCAAACCCAGAGAAGATGATCACCCAGTAA
AA sequence Show only first row Show all	>Potri.013G128200.1 pacid=42811842 polypeptide=Potri.013G128200.1.p locus=Potri.013G128200 ID=Potri.013G128200.1.v4.1 annot-version=v4.1 MAVKIRLARLGCKNRAFYRIVAADSHTPRDGKHLQVLGFYDPLAAKGDARRLGLNVDLVKYWLSVGAQPTDTVRGILMRAGLISPPPMVVMGQKKGPSGD TSNPEKMITQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34620		SSR16	small subunit ribosomal protei...		Potri.013G128200 [exp]	0	1
AT4G37925		NdhM, NDH-M	NADH dehydrogenase-like comple...		Potri.005G183000 [exp]	3.00	0.9758
AT2G38140		PSRP4	plastid-specific ribosomal pro...		Potri.016G113700 [exp]	3.00	0.9733	Pt-PSRP4.1
AT5G02120		PDE335, OHP	PIGMENT DEFECTIVE 335, one hel...		Potri.006G088200 [exp]	3.74	0.9663
AT5G45680		ATFKBP13	FK506 BINDING PROTEIN 13, FK50...		Potri.001G075500 [exp]	4.89	0.9716
AT3G23760			unknown protein		Potri.015G108200 [exp]	7.07	0.9720
AT5G65220			Ribosomal L29 family protein ...		Potri.007G093700 [exp]	7.48	0.9751
AT2G24020			Uncharacterised BCR, YbaB fami...		Potri.018G105600 [exp]	9.89	0.9526
AT4G21445			unknown protein		Potri.011G041800 [exp]	10.58	0.9724
AT2G14880			SWIB/MDM2 domain superfamily p...		Potri.001G297400 [exp]	11.61	0.9660
AT4G13220			unknown protein		Potri.002G251800 [exp]	14.00	0.9716

Compare expression of checked genes

Potri.013G128200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.