Potri.013G129600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47320 101 / 9e-28 RPS19 ribosomal protein S19 (.1)
ATCG00820 52 / 9e-10 ATCG00820.1, RPS19 ribosomal protein S19 (.1)
AT4G13850 52 / 3e-09 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
AT1G04270 44 / 3e-06 RPS15 cytosolic ribosomal protein S15 (.1.2)
AT5G09490 43 / 9e-06 Ribosomal protein S19 family protein (.1)
AT5G43640 42 / 2e-05 Ribosomal protein S19 family protein (.1)
AT5G09510 41 / 2e-05 Ribosomal protein S19 family protein (.1.2)
AT5G09500 41 / 4e-05 Ribosomal protein S19 family protein (.1)
AT5G63070 39 / 0.0004 Ribosomal protein S19 family protein (.1)
AT5G61030 39 / 0.0004 GR-RBP3 glycine-rich RNA-binding protein 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G129100 115 / 6e-31 AT5G09950 1287 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.019G101950 74 / 3e-18 AT5G47320 74 / 1e-17 ribosomal protein S19 (.1)
Potri.017G059000 70 / 4e-16 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.001G319900 60 / 3e-12 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.001G319800 59 / 7e-12 AT4G13850 137 / 2e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.011G074301 54 / 1e-10 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1)
Potri.005G154674 54 / 2e-10 ATCG00820 167 / 9e-56 ribosomal protein S19 (.1)
Potri.013G137688 54 / 2e-10 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1)
Potri.019G013302 43 / 3e-06 ATCG00820 109 / 7e-33 ribosomal protein S19 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027711 111 / 2e-32 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1)
Lus10003009 112 / 1e-29 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Lus10022551 62 / 4e-13 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10016639 58 / 2e-11 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10032591 56 / 9e-11 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10043158 50 / 2e-08 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10008692 44 / 2e-06 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1)
Lus10026127 44 / 4e-06 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1)
Lus10021886 44 / 1e-05 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1)
Lus10041168 42 / 4e-05 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00203 Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence
>Potri.013G129600.2 pacid=42811897 polypeptide=Potri.013G129600.2.p locus=Potri.013G129600 ID=Potri.013G129600.2.v4.1 annot-version=v4.1
ATGGCATTTTGTAACAAATTTGGGAGCTTGGTGAGGCAGAGCATATACCAAAATGGGCAAGTTCTAATGGGTCCTATGCTGAATTCAATTCGCTGCATGC
CATCGACAAACCTTTTTATTCGAGGTTTTGCATCCGGAGTGCCTTTTATCGATGCGTGCTTGTTTCGTCTGAAGCAAAAGAAAGAGAGTATTTCAAACAA
AAAAATCTGGACACGCAGATCAACTATTTTACCGGAATACATTAATAATTATGTACGAATTTACAATGGAAAAACTTTTGTTCGTGTTAAGATCACTGAA
GGGAAGGTTGGTCATAAATTTGGAGAGTTTGCTTTTACACGAAAAGGAAGAGTTAAGACAGCTCTTGTGAAAGGAAGAGGTAAGACAAAGAAGTAG
AA sequence
>Potri.013G129600.2 pacid=42811897 polypeptide=Potri.013G129600.2.p locus=Potri.013G129600 ID=Potri.013G129600.2.v4.1 annot-version=v4.1
MAFCNKFGSLVRQSIYQNGQVLMGPMLNSIRCMPSTNLFIRGFASGVPFIDACLFRLKQKKESISNKKIWTRRSTILPEYINNYVRIYNGKTFVRVKITE
GKVGHKFGEFAFTRKGRVKTALVKGRGKTKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47320 RPS19 ribosomal protein S19 (.1) Potri.013G129600 0 1
AT5G43960 Nuclear transport factor 2 (NT... Potri.014G192900 1.41 0.8999
AT2G27490 ATCOAE dephospho-CoA kinase family (.... Potri.008G053601 3.46 0.8813
AT2G40060 CLC2 clathrin light chain 2, Clathr... Potri.008G066800 4.24 0.8749
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.019G014386 5.29 0.8505
AT5G22540 Plant protein of unknown funct... Potri.004G187100 5.47 0.8693
AT1G31860 HISN2, AT-IE HISTIDINE BIOSYNTHESIS 2, hist... Potri.001G391400 6.48 0.8342 Pt-IE.1
AT5G61030 GR-RBP3 glycine-rich RNA-binding prote... Potri.012G061600 7.48 0.8709
AT3G15351 unknown protein Potri.002G142000 8.48 0.8628
AT5G63480 unknown protein Potri.012G099200 8.94 0.8458
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Potri.018G011300 10.19 0.8494

Potri.013G129600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.