Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 62 / 1e-12 MLP423 MLP-like protein 423 (.1.2) AT1G23120 55 / 3e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70880 51 / 2e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70870 49 / 5e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70890 49 / 9e-08 MLP43 MLP-like protein 43 (.1) AT1G70840 42 / 2e-05 MLP31 MLP-like protein 31 (.1) AT1G70830 42 / 4e-05 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT1G70850 42 / 5e-05 MLP34 MLP-like protein 34 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G111000 [exp] 51 / 2e-08 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.001G405600 [exp] 49 / 9e-08 ND / Potri.011G127800 [exp] 47 / 5e-07 ND / Potri.008G131300 [exp] 44 / 8e-06 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G032900 [exp] 39 / 0.0005 AT1G24020 59 / 2e-11 MLP-like protein 423 (.1.2) Potri.008G212400 [exp] 38 / 0.0009 ND / Potri.004G033000 [exp] 38 / 0.0009 AT1G24020 57 / 1e-10 MLP-like protein 423 (.1.2) Potri.010G000600 [exp] 38 / 0.001 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039830 [exp] 218 / 4e-74 AT1G24020 62 / 1e-12 MLP-like protein 423 (.1.2) Lus10018595 [exp] 212 / 1e-71 AT1G24020 63 / 4e-13 MLP-like protein 423 (.1.2) Lus10030840 [exp] 66 / 6e-14 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2) Lus10030646 [exp] 65 / 7e-14 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2) Lus10020498 [exp] 48 / 2e-07 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012466 [exp] 46 / 1e-06 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012742 [exp] 44 / 8e-06 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5) Lus10008932 [exp] 44 / 1e-05 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10041320 [exp] 40 / 0.0002 ND 37 / 0.003 Lus10037393 [exp] 40 / 0.0003 AT2G26040 39 / 5e-04 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.013G131000.1 pacid=42812503 polypeptide=Potri.013G131000.1.p locus=Potri.013G131000 ID=Potri.013G131000.1.v4.1 annot-version=v4.1 ATGAGAAGCATGAAGGGAGAAGTAGAGCTCAACGTTCCTGCAGAGAAAGCTTGGGAGATGTACAGAGACAATGAGATCATTAGCAAAATCAATCCTGAAA TGCTTGCCCTTGCTGAATACATCGAAGGAGACGGCAGCCCTGGAAGTCTCAGGCTCTTCAGGCTGGGACCTGCTGTAAGCAGCTACGTGAAGGAATCCAC GCAGAAGATAGAGAAGGTAGAGATTGGAAGGTCTGTCACATATCGCGTTGTTGGGGGTGACCTTAGGGACATGTATGATCCTTATAGGGTTACGTTTTCA TTTTTTCCAGTGGAAGGAAAGGAGGAGGAGAAATGTATTGCTGAATGGAAGGCTGACTATGAGCTACTGAATTCATCAACGCCTCCCCCAGACAAAGCAA GGGATGCTGCCCTAGGTTTCCTCAAGTCGTTTGACAAGTTGGAGCCAAGCTATTAA
AA sequence Show only first row Show all	>Potri.013G131000.1 pacid=42812503 polypeptide=Potri.013G131000.1.p locus=Potri.013G131000 ID=Potri.013G131000.1.v4.1 annot-version=v4.1 MRSMKGEVELNVPAEKAWEMYRDNEIISKINPEMLALAEYIEGDGSPGSLRLFRLGPAVSSYVKESTQKIEKVEIGRSVTYRVVGGDLRDMYDPYRVTFS FFPVEGKEEEKCIAEWKADYELLNSSTPPPDKARDAALGFLKSFDKLEPSY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.013G131000 [exp]	0	1
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Potri.012G105700 [exp]	4.89	0.9217
AT1G27040			Major facilitator superfamily ...		Potri.014G036200 [exp]	8.24	0.9167
AT4G35160			O-methyltransferase family pro...		Potri.013G120800 [exp]	9.48	0.9080	FOMT11,OOMT2.19
AT4G03965			RING/U-box superfamily protein...		Potri.004G003101 [exp]	10.81	0.9133
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Potri.001G025200 [exp]	11.83	0.9084
AT2G27550		ATC	centroradialis (.1)		Potri.009G165100 [exp]	13.78	0.8823	Pt-TFL1.1
AT1G19715			Mannose-binding lectin superfa...		Potri.005G232400 [exp]	13.96	0.8626
AT1G19900			glyoxal oxidase-related protei...		Potri.005G235500 [exp]	15.74	0.9001
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Potri.005G181500 [exp]	16.49	0.8883
AT4G35160			O-methyltransferase family pro...		Potri.013G120900 [exp]	17.54	0.8947	Pt-OOMT2.3

Compare expression of checked genes

Potri.013G131000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.