Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03650 242 / 3e-83 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT5G11340 47 / 4e-07 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT5G13780 41 / 8e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT3G02980 41 / 0.0001 MCC1 MEIOTIC CONTROL OF CROSSOVERS1 (.1) AT2G06025 40 / 0.0003 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT2G39000 39 / 0.0005 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) AT5G16800 38 / 0.001 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G134000 [exp] 322 / 7e-115 AT1G03650 240 / 2e-82 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.018G032400 [exp] 53 / 2e-09 AT5G11340 270 / 4e-94 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.006G248900 [exp] 50 / 4e-08 AT5G11340 280 / 3e-98 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.001G261800 [exp] 42 / 3e-05 AT5G13780 301 / 8e-106 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.010G222900 [exp] 41 / 0.0001 AT2G39000 370 / 5e-130 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Potri.008G039300 [exp] 40 / 0.0002 AT2G39000 387 / 1e-135 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Potri.009G056600 [exp] 40 / 0.0002 AT5G13780 307 / 5e-108 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.006G142100 [exp] 39 / 0.0008 AT2G06025 347 / 1e-120 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025567 [exp] 235 / 3e-80 AT1G03650 233 / 8e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10013120 [exp] 49 / 1e-07 AT5G11340 256 / 8e-89 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10008088 [exp] 49 / 2e-07 AT5G11340 249 / 2e-85 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10040401 [exp] 40 / 0.0004 AT2G39000 386 / 3e-136 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Lus10023517 [exp] 40 / 0.0005 AT2G39000 388 / 4e-137 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Lus10016378 [exp] 39 / 0.0006 AT5G13780 292 / 5e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0257 [poplar] [flax] Acetyltrans PF00583 [poplar] [flax] Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence Show only first row Show all	>Potri.013G134102.1 pacid=42812091 polypeptide=Potri.013G134102.1.p locus=Potri.013G134102 ID=Potri.013G134102.1.v4.1 annot-version=v4.1 ATGGGGAGTGAGGTCATAGTGGAGCTCCAAAGAAACTCAACCAACTGGGCCAACGTCGTGGGAGAGATTGTGAAGATAGAAAGAAAGATCTTCCCGAAAC ATGAATCACTTGCTAGATCATTTGATGAAGAGCTTAGAAAGAAGAATTCAGGGCTTCTATATACTGAACTAAATGGAGAAGTTGCTGGCTATGCCATGTA TTCCTGGCCCTCTTCTTTGTGTGCTTCTATCACAAAACTTGCAGTGAAGGAGAACTATAGAAGGCAAGGCCATGGAGAGGCATTGCTTAAAGCAGCAATT GAGAAATGCAAAAAGAGAAAGGTTCAACGTATATCACTACACGTTGATCCCCTGAGGAGTGCAGCTATGACTCTATACAAGAAACTTGGTTTTCAAGTTG ATAGTTTGGTAGAAGGTTATTACTCTTCAGACAGAAATGCTTATAGAATGTACTTGGATTCTGAATCTGACTAG
AA sequence Show only first row Show all	>Potri.013G134102.1 pacid=42812091 polypeptide=Potri.013G134102.1.p locus=Potri.013G134102 ID=Potri.013G134102.1.v4.1 annot-version=v4.1 MGSEVIVELQRNSTNWANVVGEIVKIERKIFPKHESLARSFDEELRKKNSGLLYTELNGEVAGYAMYSWPSSLCASITKLAVKENYRRQGHGEALLKAAI EKCKKRKVQRISLHVDPLRSAAMTLYKKLGFQVDSLVEGYYSSDRNAYRMYLDSESD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G03650			Acyl-CoA N-acyltransferases (N...		Potri.013G134102 [exp]	0	1
AT1G03650			Acyl-CoA N-acyltransferases (N...		Potri.013G134000 [exp]	1.00	0.9540
					Potri.009G050900 [exp]	6.70	0.7669
AT3G05760	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.013G010300 [exp]	8.83	0.6860
AT5G66631			Tetratricopeptide repeat (TPR)...		Potri.005G128600 [exp]	13.85	0.7621
AT5G54580			RNA-binding (RRM/RBD/RNP motif...		Potri.011G130300 [exp]	14.56	0.7673
AT1G60080			3'-5'-exoribonuclease family p...		Potri.016G055600 [exp]	15.49	0.7117
ATCG00300		ATCG00300.1, YC...	YCF9 (.1)		Potri.013G142548 [exp]	16.52	0.7587
AT5G64650			Ribosomal protein L17 family p...		Potri.005G061700 [exp]	18.73	0.7253
AT2G37020			Translin family protein (.1.2)		Potri.006G126200 [exp]	21.49	0.7119
AT1G10865			unknown protein		Potri.010G248800 [exp]	23.36	0.7083

Compare expression of checked genes

Potri.013G134102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.