Potri.013G136466 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01310 253 / 2e-86 ATCG01310.1, RPL2.2 ribosomal protein L2 (.1)
ATCG00830 253 / 2e-86 ATCG00830.1, RPL2.1 ribosomal protein L2 (.1)
ATMG00560 59 / 4e-11 ATMG00560.1, RPL2 Nucleic acid-binding, OB-fold-like protein (.1)
AT2G07715 59 / 5e-11 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G154300 262 / 5e-92 ATCG01310 246 / 6e-84 ribosomal protein L2 (.1)
Potri.011G074401 229 / 4e-76 ATCG01310 376 / 2e-131 ribosomal protein L2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037433 64 / 1e-12 AT2G07715 191 / 2e-57 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain
Representative CDS sequence
>Potri.013G136466.1 pacid=42812228 polypeptide=Potri.013G136466.1.p locus=Potri.013G136466 ID=Potri.013G136466.1.v4.1 annot-version=v4.1
ATGGCGATACATTTATACAAAACTTCTACCCCGAGCACACGCAATGGAGCCGTAGACAGTCAAGTGAAATCCAATACACGAAATAATTTGATCTATGGGC
AGCATCGTTGTGGTAAAGGCCGTAATTCCAGAGGAATCATTACCGCAAGGCATAGAGGGGGAGGTCATAAACGTCTATACCGTAAAATCGATTTTCGACG
GAATGAAAAATACATATATGGTAGAATCGTAACCATAGAATACGACCCTAATCGAAATGCATACATTTGTCTCATACACTATGGGGATGGTGAGAAGAGA
TATATTTTACATCCCAGAGGGGCTATAATTGGAGATACCATTATTTCTGGTACAGAAGTTCCTATAAAAATGGGAAATGCCCTACCTTTGAGTGCGGTTT
GA
AA sequence
>Potri.013G136466.1 pacid=42812228 polypeptide=Potri.013G136466.1.p locus=Potri.013G136466 ID=Potri.013G136466.1.v4.1 annot-version=v4.1
MAIHLYKTSTPSTRNGAVDSQVKSNTRNNLIYGQHRCGKGRNSRGIITARHRGGGHKRLYRKIDFRRNEKYIYGRIVTIEYDPNRNAYICLIHYGDGEKR
YILHPRGAIIGDTIISGTEVPIKMGNALPLSAV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G136466 0 1
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.011G074401 1.73 0.9993
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.005G154300 4.00 0.9976
AT2G34500 CYP710A1 cytochrome P450, family 710, s... Potri.004G131700 4.58 0.9859 CYP710.1
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.005G154674 6.32 0.9981
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.013G137688 9.00 0.9968
ATCG00750 ATCG00750.1, RP... ribosomal protein S11 (.1) Potri.010G032501 9.16 0.9940
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301 10.00 0.9955
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.013G138612 11.74 0.9844
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G137077 12.24 0.9917
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.010G052900 12.24 0.9820

Potri.013G136466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.