Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG01310 243 / 2e-82 ATCG01310.1, RPL2.2 ribosomal protein L2 (.1) ATCG00830 243 / 2e-82 ATCG00830.1, RPL2.1 ribosomal protein L2 (.1) AT2G44065 94 / 1e-24 Ribosomal protein L2 family (.1.2) AT3G51190 69 / 1e-14 Ribosomal protein L2 family (.1) AT4G36130 64 / 9e-13 Ribosomal protein L2 family (.1) AT2G18020 61 / 1e-11 EMB2296 embryo defective 2296, Ribosomal protein L2 family (.1) AT4G14250 41 / 0.0002 structural constituent of ribosome (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G074401 [exp] 214 / 4e-70 ATCG01310 376 / 2e-131 ribosomal protein L2 (.1) Potri.017G007700 [exp] 99 / 9e-27 AT2G44065 200 / 3e-65 Ribosomal protein L2 family (.1.2) Potri.007G142200 [exp] 99 / 2e-26 AT2G44065 197 / 4e-64 Ribosomal protein L2 family (.1.2) Potri.005G115700 [exp] 60 / 3e-11 AT4G36130 492 / 5e-179 Ribosomal protein L2 family (.1) Potri.007G013101 [exp] 60 / 3e-11 AT4G36130 493 / 3e-179 Ribosomal protein L2 family (.1) Potri.007G013000 [exp] 60 / 3e-11 AT4G36130 493 / 3e-179 Ribosomal protein L2 family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001687 [exp] 249 / 1e-85 ATCG00830 281 / 3e-96 ribosomal protein L2 (.1) Lus10001572 [exp] 101 / 3e-27 AT2G44065 238 / 8e-80 Ribosomal protein L2 family (.1.2) Lus10004973 [exp] 102 / 4e-26 AT1G07510 815 / 0.0 FTSH protease 10 (.1) Lus10025966 [exp] 60 / 2e-11 AT4G36130 499 / 0.0 Ribosomal protein L2 family (.1) Lus10028468 [exp] 60 / 2e-11 AT4G36130 495 / 4e-180 Ribosomal protein L2 family (.1) Lus10041923 [exp] 60 / 3e-11 AT4G36130 502 / 0.0 Ribosomal protein L2 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0107 [poplar] [flax] KOW PF03947 [poplar] [flax] Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.013G137077.1 pacid=42811690 polypeptide=Potri.013G137077.1.p locus=Potri.013G137077 ID=Potri.013G137077.1.v4.1 annot-version=v4.1 ATGCCCTTAGGCACGGCCATACATAACATAGAAATCACACTTGGAAGGGGTGGACAATTAGCTAGAGCTGCAGGTGCTGTAGCGAAACTGATTGCAAAAG AGGGGAAATCGGCCACATTAAAATTACCTTCTGGGGAGGTTCGTTTAATATCCAAAAACTGCTCAGCAACAGTCGGACAAGTAGGGAATGCTGGGGTGAA CCAGAAAAGTTTGGGTAGAGCCGGATCTAAATGTTGGCTAGGTAAACGTCCTGTAGTAAGAGGAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGT GGTGAGGGGAGGGCCCCAATTGGTAGAAAAAAACCCGCAACCCCTTGGGGTTATCCTGCACTTGGAAGAAGAAGTAGAAAAAGGAATAAATATAGTGATA ATTTGATTCTTCGTCGCCGCAGTAAATAG
AA sequence Show only first row Show all	>Potri.013G137077.1 pacid=42811690 polypeptide=Potri.013G137077.1.p locus=Potri.013G137077 ID=Potri.013G137077.1.v4.1 annot-version=v4.1 MPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNAGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGG GEGRAPIGRKKPATPWGYPALGRRSRKRNKYSDNLILRRRSK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
ATCG01310		ATCG01310.1, RP...	ribosomal protein L2 (.1)		Potri.013G137077 [exp]	0	1
ATCG00820		ATCG00820.1, RP...	ribosomal protein S19 (.1)		Potri.011G074301 [exp]	1.73	0.9986
ATCG00820		ATCG00820.1, RP...	ribosomal protein S19 (.1)		Potri.013G137688 [exp]	5.47	0.9968
ATCG00800		ATCG00800.1, RP...	structural constituent of ribo...		Potri.002G235600 [exp]	5.74	0.9884
ATCG00820		ATCG00820.1, RP...	ribosomal protein S19 (.1)		Potri.005G154674 [exp]	9.16	0.9950
ATCG01310		ATCG01310.1, RP...	ribosomal protein L2 (.1)		Potri.011G074401 [exp]	10.39	0.9947
ATCG01310		ATCG01310.1, RP...	ribosomal protein L2 (.1)		Potri.013G136466 [exp]	12.24	0.9917
ATCG00170		ATCG00170.1, RP...	DNA-directed RNA polymerase fa...		Potri.019G027580 [exp]	13.11	0.9620
AT1G50030		TOR	target of rapamycin (.1.2)		Potri.009G084500 [exp]	14.07	0.9436
ATCG00210		ATCG00210.1, YC...	electron transporter, transfer...		Potri.013G142332 [exp]	15.49	0.9633
ATCG01310		ATCG01310.1, RP...	ribosomal protein L2 (.1)		Potri.005G154300 [exp]	15.71	0.9876

Compare expression of checked genes

Potri.013G137077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.