Potri.013G137688 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00820 169 / 1e-56 ATCG00820.1, RPS19 ribosomal protein S19 (.1)
AT5G47320 65 / 4e-14 RPS19 ribosomal protein S19 (.1)
AT5G63070 51 / 2e-09 Ribosomal protein S19 family protein (.1)
AT5G09490 47 / 7e-08 Ribosomal protein S19 family protein (.1)
AT5G09500 44 / 2e-06 Ribosomal protein S19 family protein (.1)
AT1G04270 42 / 7e-06 RPS15 cytosolic ribosomal protein S15 (.1.2)
AT5G09510 41 / 1e-05 Ribosomal protein S19 family protein (.1.2)
AT5G43640 40 / 4e-05 Ribosomal protein S19 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G154674 184 / 1e-62 ATCG00820 167 / 9e-56 ribosomal protein S19 (.1)
Potri.011G074301 183 / 5e-62 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1)
Potri.019G013302 121 / 8e-38 ATCG00820 109 / 7e-33 ribosomal protein S19 (.1)
Potri.013G129600 53 / 3e-10 AT5G47320 103 / 2e-28 ribosomal protein S19 (.1)
Potri.005G219700 44 / 1e-06 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1)
Potri.002G043200 44 / 2e-06 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1)
Potri.010G076900 44 / 2e-06 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2)
Potri.019G101950 40 / 1e-05 AT5G47320 74 / 1e-17 ribosomal protein S19 (.1)
Potri.008G161901 37 / 0.0001 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027711 61 / 4e-13 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1)
Lus10003009 60 / 9e-12 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Lus10026127 45 / 4e-07 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1)
Lus10007469 45 / 8e-07 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1)
Lus10024865 44 / 9e-07 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1)
Lus10018777 44 / 1e-06 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2)
Lus10033856 44 / 1e-06 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2)
Lus10008692 42 / 3e-06 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1)
Lus10041168 43 / 8e-06 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2)
Lus10021886 42 / 1e-05 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00203 Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence
>Potri.013G137688.1 pacid=42811964 polypeptide=Potri.013G137688.1.p locus=Potri.013G137688 ID=Potri.013G137688.1.v4.1 annot-version=v4.1
ATGACACGTTCACTAAAAAAAAATCCTTTTGTAGCAAATCATTTATTAAGAAAAATAAATAAACTTAACACAAAGGCAGAAAAAAATTTAATAGTAACGT
GGTCCCGGGCATCTACCATTATACCCACAATGATCGGCCATACTATTGCTATCCATAATGGGAAGGAGCATTTACCTATTTATATAACAGATCGTATGGT
GGGTCATAAATTAGGAGAATTTGCACCTACTCTCAATTTCCGGGGACATGCAAAAAATGATAATAAATCTCGTCGTTAA
AA sequence
>Potri.013G137688.1 pacid=42811964 polypeptide=Potri.013G137688.1.p locus=Potri.013G137688 ID=Potri.013G137688.1.v4.1 annot-version=v4.1
MTRSLKKNPFVANHLLRKINKLNTKAEKNLIVTWSRASTIIPTMIGHTIAIHNGKEHLPIYITDRMVGHKLGEFAPTLNFRGHAKNDNKSRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.013G137688 0 1
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.005G154674 1.00 0.9991
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301 1.73 0.9989
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G137077 5.47 0.9968
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.011G074401 6.48 0.9984
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G136466 9.00 0.9968
AT1G50030 TOR target of rapamycin (.1.2) Potri.009G084500 10.95 0.9446
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.005G154300 12.48 0.9932
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.010G052900 13.26 0.9819
ATCG00750 ATCG00750.1, RP... ribosomal protein S11 (.1) Potri.010G032501 14.96 0.9898
AT2G34500 CYP710A1 cytochrome P450, family 710, s... Potri.004G131700 15.16 0.9819 CYP710.1

Potri.013G137688 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.