Potri.013G138612 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01300 176 / 2e-59 ATCG01300.1, RPL23.2 ribosomal protein L23 (.1)
ATCG00840 176 / 2e-59 ATCG00840.1, RPL23.1 ribosomal protein L23.1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G154350 192 / 1e-65 ATCG01300 176 / 2e-59 ribosomal protein L23 (.1)
Potri.011G074401 137 / 6e-41 ATCG01310 376 / 2e-131 ribosomal protein L2 (.1)
Potri.004G104101 52 / 2e-10 ATCG01300 52 / 1e-10 ribosomal protein L23 (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00276 Ribosomal_L23 Ribosomal protein L23
Representative CDS sequence
>Potri.013G138612.2 pacid=42810993 polypeptide=Potri.013G138612.2.p locus=Potri.013G138612 ID=Potri.013G138612.2.v4.1 annot-version=v4.1
ATGGATGGAATCAAATATGCAGTAGTTACAGACAAAAGTATTCGGTTATTGTTGAAAAATCAATATACTTCTAATGTCGAATCAGGATCAACTAGGACAG
AAATAAAGCATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGCCATCGACTCCCGGGAAAGGGTAGAAGAATGAGACCTATTATGGG
ACATACAATGCATTACAGACGTATGATCATTACGCTTCAACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAGAACTTAA
AA sequence
>Potri.013G138612.2 pacid=42810993 polypeptide=Potri.013G138612.2.p locus=Potri.013G138612 ID=Potri.013G138612.2.v4.1 annot-version=v4.1
MDGIKYAVVTDKSIRLLLKNQYTSNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMRPIMGHTMHYRRMIITLQPGYSIPPLRKKRT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.013G138612 0 1
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.005G154350 1.00 0.9975
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.005G154300 10.72 0.9853
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G136466 11.74 0.9844
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.005G150450 13.71 0.9565
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.011G074401 13.85 0.9824
ATCG00750 ATCG00750.1, RP... ribosomal protein S11 (.1) Potri.010G032501 14.00 0.9830
AT2G22795 unknown protein Potri.007G008600 17.02 0.9337
Potri.014G073900 17.20 0.9167
AT2G34500 CYP710A1 cytochrome P450, family 710, s... Potri.004G131700 17.49 0.9769 CYP710.1
AT5G36740 Acyl-CoA N-acyltransferase wit... Potri.002G051400 19.13 0.9310

Potri.013G138612 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.