Plant FIBer expression Database

Potri.013G138690 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00080 73 / 5e-20 ATCG00080.1, PSBI photosystem II reaction center protein I (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G020100
[exp]
64 / 3e-16 ATCG00080 64 / 3e-16 photosystem II reaction center protein I (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02532 PsbI Photosystem II reaction centre I protein (PSII 4.8 kDa protein)
Representative CDS sequence
>Potri.013G138690.1 pacid=42812077 polypeptide=Potri.013G138690.1.p locus=Potri.013G138690 ID=Potri.013G138690.1.v4.1 annot-version=v4.1
ATGCTTACTCTCAAACTCTTTGTTTACACAGTAGTAATATTCTTTGTTTCCCTTTTCATCTTTGGATTTTTATCTAATGATCCAGGGCGTAATCCTGGAC
GTGAAGAATAA
AA sequence
>Potri.013G138690.1 pacid=42812077 polypeptide=Potri.013G138690.1.p locus=Potri.013G138690 ID=Potri.013G138690.1.v4.1 annot-version=v4.1
MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00080 ATCG00080.1, PS... photosystem II reaction center... Potri.013G138690
[exp]
0 1
ATCG00040 ATCG00040.1, MA... maturase K (.1) Potri.013G138201
[exp]
4.69 0.9281
ATCG00070 ATCG00070.1, PS... photosystem II reaction center... Potri.013G138100
[exp]
5.65 0.8728
ATCG00640 ATCG00640.1, RP... ribosomal protein L33 (.1) Potri.003G067400
[exp]
13.85 0.8631
ATCG01040 ATCG01040.1, YC... Cytochrome C assembly protein ... Potri.001G342966
[exp]
14.83 0.8634
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.007G062202
[exp]
15.81 0.8699
ATCG00380 ATCG00380.1, RP... chloroplast ribosomal protein ... Potri.013G163300
[exp]
16.73 0.8741
ATCG00580 ATCG00580.1, PS... photosystem II reaction center... Potri.013G161900
[exp]
16.97 0.8703
Potri.013G162900
[exp]
17.43 0.7927
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.019G047540
[exp]
24.73 0.8465
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G074700
[exp]
25.09 0.8371

Potri.013G138690 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.