Potri.013G138801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATMG00810 58 / 2e-11 ATMG00810.1, ORF240B DNA/RNA polymerases superfamily protein (.1)
AT4G23160 53 / 2e-09 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024900 72 / 3e-16 AT4G23160 241 / 2e-72 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
PFAM info
Representative CDS sequence
>Potri.013G138801.1 pacid=42812318 polypeptide=Potri.013G138801.1.p locus=Potri.013G138801 ID=Potri.013G138801.1.v4.1 annot-version=v4.1
ATGCATGCTCTTACAGATTCTCTTTGGGCTGCCGTTAAACGCATTATGCGTTATCTTAAGGGTACGACAACACATGACCTACATATTACTTGTAGTTCTT
CCTTTGCATTACATGGCTTTACAGATGCAGATGGGACAAATAGTATTGATGATAGAAAATCTACGAGTGATTATCTTGTGTTTTTTGATAAGACGTCGAT
TTCGTGCAAAACAGGTAAGCAACATACAATTGCTCGCTACTCTATTGAAGTTGAGTCCAAAACCTTAGTAGATGACACTGCTGAGGTTATCTAG
AA sequence
>Potri.013G138801.1 pacid=42812318 polypeptide=Potri.013G138801.1.p locus=Potri.013G138801 ID=Potri.013G138801.1.v4.1 annot-version=v4.1
MHALTDSLWAAVKRIMRYLKGTTTHDLHITCSSSFALHGFTDADGTNSIDDRKSTSDYLVFFDKTSISCKTGKQHTIARYSIEVESKTLVDDTAEVI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATMG00810 ATMG00810.1, OR... DNA/RNA polymerases superfamil... Potri.013G138801 0 1
AT5G59845 Gibberellin-regulated family p... Potri.014G020100 2.82 0.8240
AT1G03790 C3HZnF SOM SOMNUS, Zinc finger C-x8-C-x5-... Potri.017G013400 4.24 0.7843
AT3G50120 Plant protein of unknown funct... Potri.006G042946 14.49 0.7612
AT3G55700 UDP-Glycosyltransferase superf... Potri.010G195600 21.23 0.7523
AT1G09600 Protein kinase superfamily pro... Potri.003G003700 21.81 0.7310
AT1G53035 unknown protein Potri.011G119200 27.27 0.7800
AT1G80160 GLYI7 glyoxylase I 7, Lactoylglutath... Potri.003G009000 31.30 0.7143
AT1G53440 Leucine-rich repeat transmembr... Potri.011G073591 33.16 0.7746
AT3G59890 Dihydrodipicolinate reductase,... Potri.007G145900 49.11 0.6511
Potri.003G030200 51.62 0.7476

Potri.013G138801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.