Potri.013G142100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00220 65 / 8e-17 ATCG00220.1, PSBM photosystem II reaction center protein M (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G101301 64 / 2e-16 ATCG00220 62 / 8e-16 photosystem II reaction center protein M (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05151 PsbM Photosystem II reaction centre M protein (PsbM)
Representative CDS sequence
>Potri.013G142100.1 pacid=42812506 polypeptide=Potri.013G142100.1.p locus=Potri.013G142100 ID=Potri.013G142100.1.v4.1 annot-version=v4.1
ATGGAAGTAAATATTCTCGCATTTATTGCTACTGCACTGTTCATTCTAGTTCCTACTGCTTTTTTACTTATAATATATGTAAAAACTGTTAGTCAAAGTG
ATTAA
AA sequence
>Potri.013G142100.1 pacid=42812506 polypeptide=Potri.013G142100.1.p locus=Potri.013G142100 ID=Potri.013G142100.1.v4.1 annot-version=v4.1
MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00220 ATCG00220.1, PS... photosystem II reaction center... Potri.013G142100 0 1
Potri.002G109400 3.00 0.9375
AT4G18960 MADS AG AGAMOUS, K-box region and MADS... Potri.004G064300 3.87 0.9124
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Potri.014G122700 7.07 0.8973
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Potri.003G122000 8.00 0.8994
AT4G24700 unknown protein Potri.012G086300 9.79 0.9049
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Potri.018G028500 10.95 0.9343
AT4G12300 CYP706A4 "cytochrome P450, family 706, ... Potri.001G118400 11.74 0.8784
Potri.016G004851 12.32 0.8695
AT1G66670 NCLPP3, NCLPP4,... CLP protease proteolytic subun... Potri.004G092100 16.85 0.9204
AT2G32480 ARASP ARABIDOPSIS SERIN PROTEASE (.1... Potri.002G228600 16.97 0.9239

Potri.013G142100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.