Potri.013G142332 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00210 55 / 1e-12 ATCG00210.1, YCF6 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem IIs (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G235550 96 / 3e-28 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.013G142332.1 pacid=42812213 polypeptide=Potri.013G142332.1.p locus=Potri.013G142332 ID=Potri.013G142332.1.v4.1 annot-version=v4.1
ATGGAAAAAAATAGGGGACATAATTCACATGGATATAGTAAGTCTCGCTTGGGCTGCTTTGATGGTAGTCTTTACATTTTCCCTTTCACTCGTAGTATGG
GGAAGAAGTGGACTCTAGGGATACTACTAATTGAGTTGAGAAATGAAACTCTATAA
AA sequence
>Potri.013G142332.1 pacid=42812213 polypeptide=Potri.013G142332.1.p locus=Potri.013G142332 ID=Potri.013G142332.1.v4.1 annot-version=v4.1
MEKNRGHNSHGYSKSRLGCFDGSLYIFPFTRSMGKKWTLGILLIELRNETL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00210 ATCG00210.1, YC... electron transporter, transfer... Potri.013G142332 0 1
ATCG00130 ATCG00130.1, AT... ATPase, F0 complex, subunit B/... Potri.013G137900 2.64 0.9732
ATCG01110 ATCG01110.1, ND... NAD(P)H dehydrogenase subunit ... Potri.013G074650 6.48 0.9680
ATCG00420 ATCG00420.1, ND... NADH dehydrogenase subunit J (... Potri.013G163200 8.00 0.9620
AT3G05600 alpha/beta-Hydrolases superfam... Potri.005G023400 14.21 0.8352
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G137077 15.49 0.9633
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.013G137688 17.74 0.9627
ATCG00710 ATCG00710.1, PS... photosystem II reaction center... Potri.019G028200 19.36 0.9594
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.002G235600 19.44 0.9615
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301 23.49 0.9602
AT3G06250 FAR1_related FRS7 FAR1-related sequence 7 (.1) Potri.008G199300 23.70 0.7727

Potri.013G142332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.