Plant FIBer expression Database

Potri.013G144200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20870 42 / 9e-06 cell wall protein precursor, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018569
[exp]
45 / 3e-07 AT2G20870 39 / 6e-05 cell wall protein precursor, putative (.1)
Lus10039801
[exp]
44 / 5e-07 AT2G20870 39 / 7e-05 cell wall protein precursor, putative (.1)
PFAM info
Representative CDS sequence
>Potri.013G144200.1 pacid=42811040 polypeptide=Potri.013G144200.1.p locus=Potri.013G144200 ID=Potri.013G144200.1.v4.1 annot-version=v4.1
ATGGCTTCCAAATCACAGTTCTCTCTTCTCGCTCTCGTTGCCCTGCTTGCAATATCCGGGCAAGTACTCGCAGGGCGTCAGATTCCGAATAATGTGGATG
TGAAACAGCCTGATTTCCTGATATCTGACAACAGTTTTCTCATTCCAGGCATTGGACGGGTGCTGGTTCCACCAACTCCCAGCTTTCCTTCTTATGATCC
ACATATGGGCATTGGTAACTATAGTCCAGGTGGAGACGATACATTCCCTCCAATTCCTAATGGTGGTGTTTCAACAGTAAACCACCCTTGA
AA sequence
>Potri.013G144200.1 pacid=42811040 polypeptide=Potri.013G144200.1.p locus=Potri.013G144200 ID=Potri.013G144200.1.v4.1 annot-version=v4.1
MASKSQFSLLALVALLAISGQVLAGRQIPNNVDVKQPDFLISDNSFLIPGIGRVLVPPTPSFPSYDPHMGIGNYSPGGDDTFPPIPNGGVSTVNHP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20870 cell wall protein precursor, p... Potri.013G144200
[exp]
0 1
AT5G62360 Plant invertase/pectin methyle... Potri.015G128400
[exp]
3.60 0.9997
AT4G33355 Bifunctional inhibitor/lipid-t... Potri.014G046500
[exp]
4.47 0.9997
Potri.011G073116
[exp]
5.47 0.9997
AT2G42990 GDSL-like Lipase/Acylhydrolase... Potri.002G219700
[exp]
6.32 0.9997
Potri.014G075251
[exp]
6.32 0.9997
AT1G33811 GDSL-like Lipase/Acylhydrolase... Potri.013G102400
[exp]
8.12 0.9997
AT1G29510 SAUR68 SMALL AUXIN UPREGULATED 68, SA... Potri.009G140900
[exp]
8.48 0.9958
Potri.007G113350
[exp]
9.16 0.9997
AT4G38770 ATPRP4, PRP4 ARABIDOPSIS THALIANA PROLINE-R... Potri.009G129900
[exp]
10.19 0.9996 PRP4.4
AT4G00165 Bifunctional inhibitor/lipid-t... Potri.014G059800
[exp]
11.22 0.9996

Potri.013G144200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.