Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) AT4G10265 102 / 2e-30 Wound-responsive family protein (.1) AT4G33560 62 / 4e-14 Wound-responsive family protein (.1) AT2G14070 48 / 6e-08 wound-responsive protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G148000 [exp] 147 / 9e-48 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1) Potri.019G116500 [exp] 143 / 2e-46 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G116800 [exp] 132 / 5e-42 AT4G10270 95 / 3e-27 Wound-responsive family protein (.1) Potri.019G117201 [exp] 128 / 2e-40 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G116866 [exp] 126 / 1e-39 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117200 [exp] 125 / 2e-39 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G117301 [exp] 124 / 7e-39 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G117500 [exp] 123 / 2e-38 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 123 / 2e-38 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039760 [exp] 115 / 5e-35 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039755 [exp] 114 / 1e-34 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 110 / 2e-33 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039753 [exp] 109 / 6e-33 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039752 [exp] 107 / 5e-32 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10039751 [exp] 105 / 3e-31 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10018530 [exp] 103 / 1e-30 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10018532 [exp] 103 / 2e-30 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10018531 [exp] 103 / 2e-30 AT4G10265 119 / 1e-36 Wound-responsive family protein (.1) Lus10039761 [exp] 99 / 1e-28 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [poplar] [flax] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Potri.013G148100.1 pacid=42811205 polypeptide=Potri.013G148100.1.p locus=Potri.013G148100 ID=Potri.013G148100.1.v4.1 annot-version=v4.1 ATGAGTTCAGCAAGCAAAGCTTGGGCTGTAGCAACTAGTATTGCAGCCGTCGAAGCCTTGAAAGATCAAGGATTCTGCAGATGGAACTACACAATAAGAT CATTACATCAACATGCCAAGAACCAAGTCAGGTCATTCTCTCTGGCCAAGAAGCTCTCTTCTCAAACTTCTAGGGCGGTTCCAGGTAAACTAAGAGAAAA TCAGAAATCAAAGCAGTCAGAGGAGTCACTGAGAAAAGTCATGTACTTAAGTTCTTGGGGTCCTTACTAG
AA sequence Show only first row Show all	>Potri.013G148100.1 pacid=42811205 polypeptide=Potri.013G148100.1.p locus=Potri.013G148100 ID=Potri.013G148100.1.v4.1 annot-version=v4.1 MSSASKAWAVATSIAAVEALKDQGFCRWNYTIRSLHQHAKNQVRSFSLAKKLSSQTSRAVPGKLRENQKSKQSEESLRKVMYLSSWGPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10270			Wound-responsive family protei...		Potri.013G148100 [exp]	0	1
AT4G10270			Wound-responsive family protei...		Potri.019G117100 [exp]	4.47	0.7358
AT1G65980		TPX1	thioredoxin-dependent peroxida...		Potri.001G423500 [exp]	6.32	0.7003
AT4G10270			Wound-responsive family protei...		Potri.019G116932 [exp]	9.16	0.6951
AT3G62930			Thioredoxin superfamily protei...		Potri.002G209000 [exp]	16.91	0.6647
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004000 [exp]	24.28	0.6692
AT1G02290			unknown protein		Potri.014G109600 [exp]	28.28	0.6442
AT1G02780		EMB2386	embryo defective 2386, Ribosom...		Potri.004G078000 [exp]	45.56	0.6614	Pt-RPL19.3
AT5G18600			Thioredoxin superfamily protei...		Potri.008G214600 [exp]	45.89	0.6588
AT2G28680			RmlC-like cupins superfamily p...		Potri.007G047200 [exp]	46.54	0.6482
AT5G09270			unknown protein		Potri.005G066900 [exp]	52.24	0.6412

Compare expression of checked genes

Potri.013G148100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.