Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-XTH9.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03210 442 / 3e-158 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) AT5G13870 312 / 1e-106 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) AT5G65730 291 / 1e-98 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1) AT2G06850 291 / 3e-98 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1) AT3G23730 289 / 8e-98 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G37800 289 / 1e-97 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1) AT4G14130 282 / 6e-95 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G25810 275 / 2e-92 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 275 / 3e-92 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57530 268 / 1e-89 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G125000 [exp] 573 / 0 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Potri.014G140300 [exp] 308 / 5e-105 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.007G008500 [exp] 305 / 6e-104 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1) Potri.003G159700 [exp] 305 / 1e-103 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.001G071000 [exp] 304 / 2e-103 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.002G060500 [exp] 294 / 1e-99 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.006G170001 [exp] 282 / 5e-95 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G169900 [exp] 282 / 5e-95 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G170100 [exp] 282 / 5e-95 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031586 [exp] 502 / 0 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10039715 [exp] 496 / 2e-179 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10018503 [exp] 493 / 5e-178 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10033755 [exp] 448 / 2e-159 AT4G03210 340 / 5e-117 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10003022 [exp] 308 / 3e-105 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10011052 [exp] 309 / 4e-105 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10040121 [exp] 305 / 7e-104 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10030923 [exp] 303 / 6e-103 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10020773 [exp] 290 / 3e-98 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 285 / 4e-96 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.013G152400.1 pacid=42811824 polypeptide=Potri.013G152400.1.p locus=Potri.013G152400 ID=Potri.013G152400.1.v4.1 annot-version=v4.1 ATGGCTGTTTCAGCATTTAAAATGTTGGGTTTCTTTGTTGGTTTCTCTTTAATGGTGGGTCTGGTTAGTTCAGTCAAGTTTGATGAGCTCTTTCAACCAA GTTGGGCTCAAGATCACTTGGCTTATGAAGGAGAGCTTCTTAGGCTCAAACTTGATAGTTATTCTGGTGCTGGATTTCAATCTAAAAGCAAGTATATGTT TGGGAAAGTCACAGTACAAATTAAGCTTGTAGAGGGTGACTCTGCCGGAACTGTTACTGCTTTCTATATGTCATCCGAAGGTACAAATCACAATGAGTTT GATTTTGAGTTCCTTGGCAACACCACAGGTGAACCTTACTTGGTTCAAACCAATGTGTATGTTAATGGTGTGGGTAATAGAGAACAAAGATTGAGCCTTT GGTTTGACCCTACTAAGGATTTCCACTCTTACTCCATCTTTTGGAACCAGCGCCATGTTGTGTTTCTAGTGGATGATACCCCAATTAGATTGCACACCAA TATGGAAAACAAAGGGATTCCCTTTCCAAGGGACCAAGCTATGGGCGTATACAGCTCAATATGGAATGCAGACGATTGGGCTACACAAGGTGGCCGTGTC AAGACTGATTGGAGCCACGCACCCTTCGTCGCCTCCTACAAAGGATTTGAAATCAATGCATGTGAGTGTCCAGCATCGATAGCAGCAGATGATAACGCTA AGAAATGTAGCAGTAGTGGTGAGAAGAGGTATTGGTGGGATGAGCCAACATTGTCTGCGCTCAATGTGCACCAGAGCCATCAGCTTCTGTGGGTTAGGGC TAACCACATGACATATGACTACTGCAGTGACACTGCTAGGTTCCCAGTCACTCCTCTGGAGTGTCTGCACCATCGCCACCAGTAA
AA sequence Show only first row Show all	>Potri.013G152400.1 pacid=42811824 polypeptide=Potri.013G152400.1.p locus=Potri.013G152400 ID=Potri.013G152400.1.v4.1 annot-version=v4.1 MAVSAFKMLGFFVGFSLMVGLVSSVKFDELFQPSWAQDHLAYEGELLRLKLDSYSGAGFQSKSKYMFGKVTVQIKLVEGDSAGTVTAFYMSSEGTNHNEF DFEFLGNTTGEPYLVQTNVYVNGVGNREQRLSLWFDPTKDFHSYSIFWNQRHVVFLVDDTPIRLHTNMENKGIPFPRDQAMGVYSSIWNADDWATQGGRV KTDWSHAPFVASYKGFEINACECPASIAADDNAKKCSSSGEKRYWWDEPTLSALNVHQSHQLLWVRANHMTYDYCSDTARFPVTPLECLHHRHQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G03210		XTH9, EXGT-A6, ...	xyloglucan endotransglucosylas...		Potri.013G152400 [exp]	0	1	Pt-XTH9.2
AT2G18420			Gibberellin-regulated family p...		Potri.012G076700 [exp]	1.41	0.7663
AT4G16563			Eukaryotic aspartyl protease f...		Potri.001G158600 [exp]	6.00	0.7423
AT1G55790			Domain of unknown function (DU...		Potri.001G438100 [exp]	11.04	0.7491
AT5G06080	AS2	LBD33	LOB domain-containing protein ...		Potri.010G200400 [exp]	11.22	0.6809	LBD33.1
AT2G15320			Leucine-rich repeat (LRR) fami...		Potri.009G097100 [exp]	14.69	0.6613
AT2G25790			Leucine-rich receptor-like pro...		Potri.006G237400 [exp]	14.96	0.6651
AT4G33985			Protein of unknown function (D...		Potri.005G138100 [exp]	16.30	0.6798
AT3G14250			RING/U-box superfamily protein...		Potri.001G037200 [exp]	17.88	0.6712
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Potri.001G094700 [exp]	18.11	0.7063
AT5G59300		ATUBC7, UBC7	ARABIDOPSIS THALIANA UBIQUITIN...		Potri.008G053800 [exp]	18.76	0.6702	Pt-UBC13.3

Compare expression of checked genes

Potri.013G152400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.