Pt-PRX1.9 (Potri.013G154400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-PRX1.9
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1)
AT5G58400 346 / 3e-119 Peroxidase superfamily protein (.1)
AT5G58390 326 / 1e-111 Peroxidase superfamily protein (.1)
AT1G14550 317 / 6e-108 Peroxidase superfamily protein (.1)
AT5G06720 314 / 2e-106 ATPA2 peroxidase 2 (.1)
AT4G36430 304 / 1e-102 Peroxidase superfamily protein (.1)
AT1G14540 300 / 3e-101 Peroxidase superfamily protein (.1)
AT2G18150 299 / 1e-100 Peroxidase superfamily protein (.1)
AT5G06730 297 / 2e-99 Peroxidase superfamily protein (.1)
AT2G18140 293 / 2e-98 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G132700 390 / 1e-136 AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1)
Potri.013G083600 375 / 6e-131 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.013G156500 372 / 2e-129 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.010G236890 368 / 5e-128 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.010G236870 365 / 8e-127 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236900 363 / 3e-126 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.010G236910 357 / 7e-124 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236850 357 / 7e-124 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.014G143200 353 / 5e-122 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009937 369 / 2e-128 AT5G05340 347 / 6e-120 Peroxidase superfamily protein (.1)
Lus10034207 361 / 4e-125 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10006534 348 / 6e-120 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10032786 347 / 6e-120 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10024209 347 / 1e-119 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10030148 344 / 6e-119 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10003573 343 / 3e-118 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Lus10000346 345 / 1e-117 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10009898 340 / 6e-117 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1)
Lus10009902 338 / 2e-116 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.013G154400.1 pacid=42812309 polypeptide=Potri.013G154400.1.p locus=Potri.013G154400 ID=Potri.013G154400.1.v4.1 annot-version=v4.1
ATGGCTCTCTCAAAAATTTTCTACGGGTTATGTTTCTCTATGCTTTTGCTTGGATTAGTCCATGCACAGTTATCAACCACTTTCTATGCAACAACATGCC
CTAAAGCCCTCTCTACCATCAGAACTGCTGTACTAAAAGCAGTTGTCAAGGAGCATCGCATGGGAGCCTCCTTGCTCCGTCTCCATTTCCATGACTGCTT
CGTTAATGGATGTGATGCATCAGTCCTATTAGATGACACTTCAAGTTTTACTGGAGAAAAGACTGCAGGCCCAAATGCAAATTCTTTGAGAGGTTATGAT
GTGATTGATACCATTAAGTCTCAATTGGAGTCAATTTGCCCTGGAGTTGTTTCTTGTGCTGATATTCTGGCTGTTGCTGCTCGAGATTCAGTTGTTGCAT
TGAGTGGACCTTCATGGACAGTTCAATTGGGGAGAAGAGATTCGACCACAGCAAGTTTGGGTGCTGCTAATTCCGATCTTCCATCTCCACTCATGGATCT
GAGTGACCTTATTACTTCCTTCTCAAATAAAGGGTTCACTGCCAAAGAAATGGTTGCTCTCTCAGGATCTCACACAATAGGGCAAGCCAGGTGCCTGCTG
TTTCGAAACCGTGTCTACAATGAGACCAGCCTAGATTCAACCTTGGCAACATCATTAAAATCAAATTGTCCAAACACAGGCAGTGATGACAGCCTTTCTT
CACTGGATGCTACTACTCCTGTCACATTTGATAACTCTTATTTCAAGAACCTGGCAAACAACAAGGGCCTTTTGCACTCGGATCAACAGCTTTTCAGTGG
AGGCACTACGGACTCGCAGGTCAAGACATACAGCATCAATTCTGCTACATTCTATGCTGATTTTGCTAGTGCCATGGTAAAGATGGGTAGCATTAGCCCC
CTAACAGGAAGCGATGGACAGATTCGTACCAACTGCGCCAAAGTAAACTGA
AA sequence
>Potri.013G154400.1 pacid=42812309 polypeptide=Potri.013G154400.1.p locus=Potri.013G154400 ID=Potri.013G154400.1.v4.1 annot-version=v4.1
MALSKIFYGLCFSMLLLGLVHAQLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKTAGPNANSLRGYD
VIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTVQLGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLL
FRNRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSDQQLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISP
LTGSDGQIRTNCAKVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G05340 Peroxidase superfamily protein... Potri.013G154400 0 1 Pt-PRX1.9
AT3G22060 Receptor-like protein kinase-r... Potri.007G120600 1.41 0.9604
AT4G27290 S-locus lectin protein kinase ... Potri.011G125851 1.73 0.9325
AT3G22060 Receptor-like protein kinase-r... Potri.007G120601 2.44 0.9481
AT3G59850 Pectin lyase-like superfamily ... Potri.007G144200 4.24 0.8968
AT1G63440 HMA5 heavy metal atpase 5 (.1) Potri.003G125700 5.65 0.8459 Pt-HMA5.1
AT4G21895 DNA binding (.1) Potri.011G001901 6.00 0.9208
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Potri.011G030650 10.58 0.8800
AT3G22060 Receptor-like protein kinase-r... Potri.007G120300 13.60 0.9179
AT2G34930 disease resistance family prot... Potri.001G262800 14.49 0.9177
AT1G02460 Pectin lyase-like superfamily ... Potri.014G115700 14.69 0.8729

Potri.013G154400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.