Potri.013G156700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30330 154 / 6e-49 BLOS1 BLOC subunit 1, GCN5L1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030147 176 / 1e-57 AT2G30330 163 / 1e-52 BLOC subunit 1, GCN5L1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06320 GCN5L1 GCN5-like protein 1 (GCN5L1)
Representative CDS sequence
>Potri.013G156700.1 pacid=42811865 polypeptide=Potri.013G156700.1.p locus=Potri.013G156700 ID=Potri.013G156700.1.v4.1 annot-version=v4.1
ATGAACTCACCGCAGCGTCCATCAGCGCGTACGCGCAGGCCGCACTTACCGGAGTGTGAAAAGCCACCGCAATCGAACCCAACCGGCAACGACCTAGAGT
CATCTCTCCTCCAAATCTTCACCGATCACAACCACACCTCCCTTCGTCTCCGGGAAACCACGGTGATTGAGACAGAGAAAGCGAAGAAAGAAGCGGCGAG
AGTGGCGGATTTGTTGGTGGATAAAGTGAATGGAGGAGTGCAAGAATCGTTTGTTAATGAGAAGAGAATTGAGATGGAGATTAGAAGTTTAGCAGCAAGT
ATTGTAAGGTTTATGAAGCAGAGTGATCAGTGGCTTACTGCTACTCATTCCATTAATACCGCTATTAAGGAGATTGGGGACTTTGAGAACTGGATGAAGA
CAATGGAGTATGACTGTAAAAGCATAACCACTGCGATACACAACATTCACAAAGAATGA
AA sequence
>Potri.013G156700.1 pacid=42811865 polypeptide=Potri.013G156700.1.p locus=Potri.013G156700 ID=Potri.013G156700.1.v4.1 annot-version=v4.1
MNSPQRPSARTRRPHLPECEKPPQSNPTGNDLESSLLQIFTDHNHTSLRLRETTVIETEKAKKEAARVADLLVDKVNGGVQESFVNEKRIEMEIRSLAAS
IVRFMKQSDQWLTATHSINTAIKEIGDFENWMKTMEYDCKSITTAIHNIHKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G30330 BLOS1 BLOC subunit 1, GCN5L1 family ... Potri.013G156700 0 1
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Potri.010G071500 2.00 0.7435
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Potri.002G148000 4.47 0.6918
AT2G17787 unknown protein Potri.005G242300 4.89 0.6969
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Potri.014G113900 5.91 0.6719
AT1G17720 ATBBETA, ATB BE... Protein phosphatase 2A, regula... Potri.001G197300 11.95 0.6545 Pt-ATB.1
AT1G66920 Protein kinase superfamily pro... Potri.007G125100 13.22 0.6699
AT4G20260 ATPCAP1 ARABIDOPSIS THALIANA PLASMA-ME... Potri.001G073900 15.23 0.6195
AT2G40270 Protein kinase family protein ... Potri.008G072100 16.97 0.6704
AT4G00355 ATI2 ATG8-interacting protein 2, un... Potri.014G086000 17.66 0.6496
AT3G54300 ATVAMP727 vesicle-associated membrane pr... Potri.008G019400 18.76 0.6392 VAMP727.1

Potri.013G156700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.