Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10910 114 / 2e-32 RING/U-box superfamily protein (.1) AT5G01880 111 / 1e-31 RING/U-box superfamily protein (.1) AT5G05280 110 / 3e-31 RING/U-box superfamily protein (.1) AT1G49220 100 / 3e-26 RING/U-box superfamily protein (.1) AT1G49210 97 / 2e-25 RING/U-box superfamily protein (.1) AT1G49230 96 / 5e-25 RING/U-box superfamily protein (.1) AT1G49200 93 / 9e-24 RING/U-box superfamily protein (.1) AT3G18773 91 / 8e-23 RING/U-box superfamily protein (.1) AT1G72220 90 / 1e-21 RING/U-box superfamily protein (.1) AT4G17905 89 / 1e-21 ATL4H RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G130100 [exp] 217 / 7e-73 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1) Potri.013G091300 [exp] 157 / 4e-49 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1) Potri.019G057700 [exp] 146 / 5e-45 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1) Potri.016G136200 [exp] 139 / 3e-42 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1) Potri.019G010500 [exp] 120 / 2e-34 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 120 / 3e-34 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.001G309700 [exp] 94 / 5e-24 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1) Potri.003G075200 [exp] 90 / 3e-23 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1) Potri.005G099000 [exp] 91 / 6e-23 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029037 [exp] 134 / 2e-40 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1) Lus10022743 [exp] 110 / 5e-31 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10025146 [exp] 109 / 1e-30 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1) Lus10006788 [exp] 107 / 5e-29 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1) Lus10033515 [exp] 107 / 7e-29 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1) Lus10020859 [exp] 103 / 1e-27 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1) Lus10005817 [exp] 103 / 2e-27 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1) Lus10005814 [exp] 102 / 4e-27 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1) Lus10005815 [exp] 99 / 7e-26 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1) Lus10006785 [exp] 97 / 3e-25 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.013G157000.1 pacid=42812432 polypeptide=Potri.013G157000.1.p locus=Potri.013G157000 ID=Potri.013G157000.1.v4.1 annot-version=v4.1 ATGGAGATTTCAGTGGTATACCATACACACCGCCTATTCCTGGATACGGATTCAGGAATGCCACCTTCTAACCAAGGAGACGGGAATTCTAGCGATTACA TCCTCGGAACTGGTACAAATTTTGATGGCAAAGTGGTGATGGTTTTGGTAGCTTTGCTATTTGCATTAGTATGTGCGTTTGGGATAAACTCCATAGCACG TTGTGCCACAAGAAATGGGTATAGAATTGGCTTTGAGACTCCACAACAGGCTGCTTCACGCCTAGCTGCAGCTACTAATACAGAACTGAAGAAGAGTGCG TTGGGGCAGATTCCGGTGGTGCCATATAAATCAGGACTACATATTCAGGTCAGTACTGATTGTCCGATTTGTCTTGGAGAATTTTCGGAAGGCGAAAAGG TAAGAGTTCTACCACAATGTAGCCATGGTTTCCATGTTAAGTGTATAGACAGATGGTTATTGTTGCACTCATCATGCCCCTTATGCCGACAAGCATTAGT ACTGCCGTAG
AA sequence Show only first row Show all	>Potri.013G157000.1 pacid=42812432 polypeptide=Potri.013G157000.1.p locus=Potri.013G157000 ID=Potri.013G157000.1.v4.1 annot-version=v4.1 MEISVVYHTHRLFLDTDSGMPPSNQGDGNSSDYILGTGTNFDGKVVMVLVALLFALVCAFGINSIARCATRNGYRIGFETPQQAASRLAAATNTELKKSA LGQIPVVPYKSGLHIQVSTDCPICLGEFSEGEKVRVLPQCSHGFHVKCIDRWLLLHSSCPLCRQALVLP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10910			RING/U-box superfamily protein...		Potri.013G157000 [exp]	0	1
AT4G27700			Rhodanese/Cell cycle control p...		Potri.015G008000 [exp]	1.73	0.9731
AT5G42070			unknown protein		Potri.003G141700 [exp]	2.00	0.9704
AT3G06430		AtPPR2, EMB2750	pentatricopeptide repeat 2, em...		Potri.010G153900 [exp]	3.87	0.9691
AT1G29660			GDSL-like Lipase/Acylhydrolase...		Potri.018G089200 [exp]	6.48	0.9608
AT1G69200		FLN2	fructokinase-like 2 (.1)		Potri.008G097300 [exp]	8.24	0.9679
AT4G27700			Rhodanese/Cell cycle control p...		Potri.012G020700 [exp]	8.66	0.9663
AT3G29670		PMAT2	phenolic glucoside malonyltran...		Potri.004G096300 [exp]	8.83	0.9611
AT3G25905		CLE27	CLAVATA3/ESR-RELATED 27 (.1)		Potri.008G120800 [exp]	9.05	0.9458
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.018G089300 [exp]	9.48	0.9580
AT4G01037		AtWTF1	what's this factor?, Ubiquitin...		Potri.014G096800 [exp]	9.79	0.9604

Compare expression of checked genes

Potri.013G157000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.