Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56380 110 / 7e-32 ARR17 response regulator 17 (.1) AT2G40670 100 / 1e-27 ARR16 response regulator 16 (.1.2) AT1G74890 100 / 2e-27 ARR15 response regulator 15 (.1) AT3G48100 97 / 3e-26 ATRR2, IBC6, ARR5 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) AT5G62920 93 / 9e-25 ARR6 response regulator 6 (.1) AT1G19050 93 / 1e-24 ARR7 response regulator 7 (.1) AT2G41310 93 / 2e-24 ARR8, ATRR3 RESPONSE REGULATOR 8, response regulator 3 (.1) AT3G57040 92 / 4e-24 ATRR4, ARR9 RESPONSE REGULATOR 4, response regulator 9 (.1) AT1G10470 89 / 7e-23 IBC7, ATRR1, ARR4, MEE7 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) AT1G59940 88 / 1e-22 ARR3 response regulator 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G133600 [exp] 145 / 8e-46 AT3G56380 183 / 2e-60 response regulator 17 (.1) Potri.019G058900 [exp] 107 / 5e-31 AT3G56380 223 / 5e-76 response regulator 17 (.1) Potri.015G070000 [exp] 100 / 1e-27 AT3G48100 231 / 1e-77 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Potri.016G038000 [exp] 99 / 9e-27 AT2G41310 242 / 2e-81 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.003G197466 [exp] 92 / 3e-24 AT2G41310 232 / 5e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.T124806 [exp] 91 / 7e-24 AT2G41310 232 / 6e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.006G041100 [exp] 91 / 2e-23 AT3G57040 273 / 4e-93 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.001G027000 [exp] 88 / 9e-23 AT2G41310 203 / 2e-66 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.010G037800 [exp] 88 / 3e-22 AT1G59940 202 / 5e-65 response regulator 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042153 [exp] 98 / 1e-26 AT3G48100 213 / 1e-70 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10004243 [exp] 98 / 2e-26 AT3G48100 220 / 2e-73 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10039524 [exp] 94 / 8e-25 AT3G57040 222 / 2e-73 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10016334 [exp] 89 / 9e-23 AT3G57040 211 / 5e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10002750 [exp] 89 / 1e-22 AT3G57040 212 / 4e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10029211 [exp] 89 / 2e-22 AT1G10470 211 / 4e-68 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10030664 [exp] 86 / 3e-21 AT1G10470 206 / 2e-65 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10030822 [exp] 85 / 6e-21 AT1G59940 201 / 2e-64 response regulator 3 (.1) Lus10007885 [exp] 69 / 4e-15 AT2G41310 143 / 1e-42 RESPONSE REGULATOR 8, response regulator 3 (.1) Lus10030359 [exp] 64 / 3e-13 AT2G41310 142 / 3e-42 RESPONSE REGULATOR 8, response regulator 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [poplar] [flax] CheY PF00072 [poplar] [flax] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Potri.013G157750.1 pacid=42812203 polypeptide=Potri.013G157750.1.p locus=Potri.013G157750 ID=Potri.013G157750.1.v4.1 annot-version=v4.1 ATGGCCGGCTCTTCTTCATCATCACCATCAATGGGGTTTGATTTTGATGAGAAACTACATGTTTTAGCTGTTGAAGCTGTTGATGATGGCTTGATAGATC GGAAAGCTATTGAAAGGTTACTCATCAACTCTGAATATAAAGTGACCACAGCAGAAAATAAAAAGAAAGCAATTGAATATTTGGGGTTAGCTGATGGACA TCACACCAATCACGGTGTGCAGGACTTGAAGGTGAACCTGATCATCACAGACTATTGCATGCGAGGAATGACAGGGTATGAGTTATTGAAAAGAATTAAG GAATCACCTACCATGAAAGGAGATACCAGTAGTTGTAGTGTCATCTGA
AA sequence Show only first row Show all	>Potri.013G157750.1 pacid=42812203 polypeptide=Potri.013G157750.1.p locus=Potri.013G157750 ID=Potri.013G157750.1.v4.1 annot-version=v4.1 MAGSSSSSPSMGFDFDEKLHVLAVEAVDDGLIDRKAIERLLINSEYKVTTAENKKKAIEYLGLADGHHTNHGVQDLKVNLIITDYCMRGMTGYELLKRIK ESPTMKGDTSSCSVI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56380		ARR17	response regulator 17 (.1)		Potri.013G157750 [exp]	0	1
AT1G77060			Phosphoenolpyruvate carboxylas...		Potri.002G073600 [exp]	18.11	0.6835
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G183800 [exp]	42.14	0.6494
AT5G18020			SAUR-like auxin-responsive pro...		Potri.004G166300 [exp]	43.63	0.6536
					Potri.014G064950 [exp]	49.56	0.6483
AT2G23940			Protein of unknown function (D...		Potri.006G179600 [exp]	59.98	0.4907
					Potri.009G013701 [exp]	68.83	0.6287
					Potri.006G071801 [exp]	69.19	0.5806
					Potri.005G226050 [exp]	74.22	0.6043
AT3G03010			Peptidyl-tRNA hydrolase II (PT...		Potri.013G082850 [exp]	80.59	0.5909
AT3G01820			P-loop containing nucleoside t...		Potri.012G095700 [exp]	90.12	0.5810

Compare expression of checked genes

Potri.013G157750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.